Details of the Target
General Information of Target
Target ID | LDTP10093 | |||||
---|---|---|---|---|---|---|
Target Name | Mitochondrial calcium uniporter regulator 1 (MCUR1) | |||||
Gene Name | MCUR1 | |||||
Gene ID | 63933 | |||||
Synonyms |
C6orf79; CCDC90A; Mitochondrial calcium uniporter regulator 1; MCU regulator 1; Coiled-coil domain-containing protein 90A, mitochondrial |
|||||
3D Structure | ||||||
Sequence |
MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMA
YSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPS EQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGCLNVKATFYDTYSLSYDLHCCGA KRIMKEAFRWALFSMQATGHVLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ |
|||||
Target Bioclass |
Other
|
|||||
Family |
CCDC90 family
|
|||||
Subcellular location |
Mitochondrion inner membrane
|
|||||
Function |
Key regulator of mitochondrial calcium uniporter (MCU) required for calcium entry into mitochondrion. Plays a direct role in uniporter-mediated calcium uptake via a direct interaction with MCU. Probably involved in the assembly of the membrane components of the uniporter complex (uniplex).
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STPyne Probe Info |
![]() |
K283(2.95) | LDD0277 | [1] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0227 | [2] | |
AOyne Probe Info |
![]() |
15.00 | LDD0443 | [3] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C165 Probe Info |
![]() |
13.93 | LDD1845 | [4] | |
C166 Probe Info |
![]() |
13.27 | LDD1846 | [4] | |
C187 Probe Info |
![]() |
24.76 | LDD1865 | [4] | |
C201 Probe Info |
![]() |
25.28 | LDD1877 | [4] | |
C218 Probe Info |
![]() |
19.29 | LDD1892 | [4] | |
C220 Probe Info |
![]() |
19.84 | LDD1894 | [4] | |
C278 Probe Info |
![]() |
62.25 | LDD1948 | [4] | |
C285 Probe Info |
![]() |
19.43 | LDD1955 | [4] | |
C287 Probe Info |
![]() |
8.63 | LDD1957 | [4] | |
C289 Probe Info |
![]() |
35.51 | LDD1959 | [4] | |
C388 Probe Info |
![]() |
57.68 | LDD2047 | [4] |
Competitor(s) Related to This Target
References