Details of the Target
General Information of Target
Target ID | LDTP05171 | |||||
---|---|---|---|---|---|---|
Target Name | Dermcidin (DCD) | |||||
Gene Name | DCD | |||||
Gene ID | 117159 | |||||
Synonyms |
AIDD; DSEP; Dermcidin; EC 3.4.-.-; Preproteolysin) [Cleaved into: Survival-promoting peptide; DCD-1] |
|||||
3D Structure | ||||||
Sequence |
MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRK
QRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL |
|||||
Target Bioclass |
Enzyme
|
|||||
Subcellular location |
Secreted
|
|||||
Function |
[DCD-1]: Found in sweat, has an antimicrobial activity during early bacterial colonization. The secreted peptide assembles into homohexameric complexes that can associate with and also insert into pathogen membranes. Once inserted in bacteria membranes forms anion channels probably altering the transmembrane potential essential for bacterial survival. Highly effective against E.coli, E.faecalis, S.aureus and C.albicans. Optimal pH and salt concentration resemble the conditions in sweat. Also exhibits proteolytic activity, cleaving on the C-terminal side of Arg and, to a lesser extent, Lys residues.; [Survival-promoting peptide]: Promotes survival of neurons and displays phosphatase activity. It may bind IgG.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
P1 Probe Info |
![]() |
1.87 | LDD0448 | [1] | |
P2 Probe Info |
![]() |
2.02 | LDD0449 | [1] | |
P3 Probe Info |
![]() |
1.54 | LDD0454 | [1] | |
YN-1 Probe Info |
![]() |
100.00 | LDD0444 | [2] | |
YN-4 Probe Info |
![]() |
100.00 | LDD0445 | [2] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
FFF probe11 Probe Info |
![]() |
20.00 | LDD0471 | [3] | |
FFF probe15 Probe Info |
![]() |
20.00 | LDD0478 | [3] | |
FFF probe6 Probe Info |
![]() |
20.00 | LDD0468 | [3] | |
FFF probe9 Probe Info |
![]() |
20.00 | LDD0470 | [3] | |
JN0003 Probe Info |
![]() |
20.00 | LDD0484 | [3] | |
PARPYnD Probe Info |
![]() |
1.43 | LDD0376 | [4] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References