General Information of Target

Target ID LDTP02757
Target Name Cytochrome b-c1 complex subunit 7 (UQCRB)
Gene Name UQCRB
Gene ID 7381
Synonyms
UQBP; Cytochrome b-c1 complex subunit 7; Complex III subunit 7; Complex III subunit VII; QP-C; Ubiquinol-cytochrome c reductase complex 14 kDa protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRM
FRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK
Target Bioclass
Enzyme
Family
UQCRB/QCR7 family
Subcellular location
Mitochondrion inner membrane
Function
Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, linking this redox reaction to translocation of protons across the mitochondrial inner membrane, with protons being carried across the membrane as hydrogens on the quinol. In the process called Q cycle, 2 protons are consumed from the matrix, 4 protons are released into the intermembrane space and 2 electrons are passed to cytochrome c.
Uniprot ID
P14927
Ensemble ID
ENST00000287022.10
HGNC ID
HGNC:12582
ChEMBL ID
CHEMBL1671612

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HCT116 SNV: p.N88K .
NCIH1155 SNV: p.Q5H .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 10 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C-Sul
 Probe Info 
5.60  LDD0066  [1]
Probe 1
 Probe Info 
Y56(4.98); Y94(19.54)  LDD3495  [2]
5E-2FA
 Probe Info 
N.A.  LDD2235  [3]
ATP probe
 Probe Info 
K45(0.00); K78(0.00)  LDD0199  [4]
NHS
 Probe Info 
K4(0.00); K12(0.00)  LDD0010  [5]
STPyne
 Probe Info 
K4(0.00); K78(0.00)  LDD0009  [5]
1c-yne
 Probe Info 
N.A.  LDD0228  [6]
1d-yne
 Probe Info 
N.A.  LDD0357  [6]
Acrolein
 Probe Info 
N.A.  LDD0217  [7]
Crotonaldehyde
 Probe Info 
N.A.  LDD0219  [7]
PAL-AfBPP Probe
Click To Hide/Show 7 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C003
 Probe Info 
17.88  LDD1713  [8]
C094
 Probe Info 
24.93  LDD1785  [8]
C231
 Probe Info 
12.13  LDD1904  [8]
C235
 Probe Info 
20.25  LDD1908  [8]
C355
 Probe Info 
28.44  LDD2016  [8]
C361
 Probe Info 
17.88  LDD2022  [8]
C390
 Probe Info 
25.46  LDD2049  [8]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [7]
 LDCM0107  IAA HeLa N.A.  LDD0221  [7]
 LDCM0109  NEM HeLa N.A.  LDD0223  [7]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
1-aminocyclopropane-1-carboxylate synthase-like protein 1 (ACCS) Class-I pyridoxal-phosphate-dependent aminotransferase family Q96QU6
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Beclin-1 (BECN1) Beclin family Q14457
Lysosomal-associated transmembrane protein 4A (LAPTM4A) LAPTM4/LAPTM5 transporter family Q15012
Neuron-specific calcium-binding protein hippocalcin (HPCA) Recoverin family P84074
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
THAP domain-containing protein 3 (THAP3) . Q8WTV1
Other
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
DNA replication complex GINS protein PSF3 (GINS3) GINS3/PSF3 family Q9BRX5
Zinc finger SWIM domain-containing protein 7 (ZSWIM7) SWS1 family Q19AV6
Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 (ACAP1) . Q15027
Centromere protein R (ITGB3BP) . Q13352
La-related protein 4B (LARP4B) . Q92615
Melanoma-associated antigen 4 (MAGEA4) . P43358
Melanoma-associated antigen B4 (MAGEB4) . O15481

The Drug(s) Related To This Target

Investigative
Click To Hide/Show 9 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
2-nonyl-4-quinolinol 1-oxide Small molecular drug DB08453
5-heptyl-6-hydroxy-13-benzothiazole-47-dione Small molecular drug DB07636
6-hydroxy-5-undecyl-47-benzothiazoledione Small molecular drug DB04799
Ubiquinone Q2 Small molecular drug DB08690
(5s)-3-anilino-5-(24-difluorophenyl)-5-methyl-13-oxazolidine-24-dione . DB07763
(S)-famoxadone . DB07778
2-hexyloxy-6-hydroxymethyl-tetrahydro-pyran-345-triol . DB04141
Azoxystrobin . DB07401
Methyl (2z)-3-methoxy-2-{2-[(E)-2-phenylvinyl]Phenyl}Acrylate . DB08330

References

1 Low-Toxicity Sulfonium-Based Probes for Cysteine-Specific Profiling in Live Cells. Anal Chem. 2022 Mar 15;94(10):4366-4372. doi: 10.1021/acs.analchem.1c05129. Epub 2022 Mar 4.
2 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
3 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
4 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
5 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
6 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
7 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
8 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587