Details of the Target
General Information of Target
| Target ID | LDTP05638 | |||||
|---|---|---|---|---|---|---|
| Target Name | CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 (ST3GAL4) | |||||
| Gene Name | ST3GAL4 | |||||
| Gene ID | 6484 | |||||
| Synonyms |
CGS23; NANTA3; SIAT4C; STZ; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4; Alpha 2,3-ST 4; Beta-galactoside alpha-2,3-sialyltransferase 4; EC 2.4.3.2; EC 2.4.3.4; Alpha 2,3-sialyltransferase IV; Gal-NAc6S; Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase; Gal-beta-1,4-GlcNAc-alpha-2,3-sialyltransferase; N-acetyllactosaminide alpha-2,3-sialyltransferase; EC 2.4.3.6; SAT-3; ST-4; ST3Gal IV; ST3GalIV; ST3GalA.2; STZ; Sialyltransferase 4C; SIAT4-C
|
|||||
| 3D Structure | ||||||
| Sequence |
MVSKSRWKLLAMLALVLVVMVWYSISREDRYIELFYFPIPEKKEPCLQGEAESKASKLFG
NYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRC VVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVE NNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIA ADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQIT LKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Glycosyltransferase 29 family
|
|||||
| Subcellular location |
Golgi apparatus, Golgi stack membrane
|
|||||
| Function |
A beta-galactoside alpha2-3 sialyltransferase involved in terminal sialylation of glycoproteins and glycolipids. Catalyzes the transfer of sialic acid (N-acetyl-neuraminic acid; Neu5Ac) from the nucleotide sugar donor CMP-Neu5Ac onto acceptor Galbeta-(1->3)-GalNAc- and Galbeta-(1->4)-GlcNAc-terminated glycoconjugates through an alpha2-3 linkage. Plays a major role in hemostasis. Responsible for sialylation of plasma VWF/von Willebrand factor, preventing its recognition by asialoglycoprotein receptors (ASGPR) and subsequent clearance. Regulates ASGPR-mediated clearance of platelets. Participates in the biosynthesis of the sialyl Lewis X epitopes, both on O- and N-glycans, which are recognized by SELE/E-selectin, SELP/P-selectin and SELL/L-selectin. Essential for selectin-mediated rolling and adhesion of leukocytes during extravasation. Contributes to adhesion and transendothelial migration of neutrophils likely through terminal sialylation of CXCR2. In glycosphingolipid biosynthesis, sialylates GM1 and GA1 gangliosides to form GD1a and GM1b, respectively. Metabolizes brain c-series ganglioside GT1c forming GQ1c. Synthesizes ganglioside LM1 (IV3Neu5Ac-nLc4Cer), a major structural component of peripheral nerve myelin.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C46(1.34) | LDD2253 | [1] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [2] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C091 Probe Info |
![]() |
21.11 | LDD1782 | [3] | |
|
C092 Probe Info |
![]() |
31.12 | LDD1783 | [3] | |
|
C094 Probe Info |
![]() |
25.46 | LDD1785 | [3] | |
|
C243 Probe Info |
![]() |
11.08 | LDD1916 | [3] | |
|
C246 Probe Info |
![]() |
18.90 | LDD1919 | [3] | |
|
C249 Probe Info |
![]() |
12.04 | LDD1922 | [3] | |
|
C278 Probe Info |
![]() |
58.89 | LDD1948 | [3] | |
|
C282 Probe Info |
![]() |
22.01 | LDD1952 | [3] | |
|
C390 Probe Info |
![]() |
34.06 | LDD2049 | [3] | |
Competitor(s) Related to This Target
References











