Details of the Target

General Information of Target

Target ID LDTP04557
Target Name Arfaptin-2 (ARFIP2)
Gene Name ARFIP2
Gene ID 23647
Synonyms
POR1; Arfaptin-2; ADP-ribosylation factor-interacting protein 2; Partner of RAC1; POR1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGD
GLIPTGSGRHPSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSR
TVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQE
EFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRT
DLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLL
FHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ
Target Bioclass
Other
Subcellular location
Golgi apparatus
Function
Plays a role in constitutive metalloproteinase (MMP) secretion from the trans Golgi network. May have important functions during vesicle biogenesis at certain cargo subdomains, which could be predominantly utilized by secreted MMPs, such as MMP7 and MMP2. Also involved in autophagy by regulating the starvation-dependent trafficking of ATG9A vesicles which deliver the phosphatidylinositol 4-kinase beta (PI4KB) to the autophagosome initiation site. Involved in phagophore growth during mitophagy by regulating ATG9A trafficking to mitochondria. In addition, plays a role in NF-kappa-B inhibition by interacting with IKBKB and IKBKG.
Uniprot ID
P53365
Ensemble ID
ENST00000254584.6
HGNC ID
HGNC:17160

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 11 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
TH211
 Probe Info  		Y104(17.35)  LDD0260  [2]
ONAyne
 Probe Info  		K290(10.00); K92(10.00)  LDD0275  [3]
Probe 1
 Probe Info  		Y184(18.97); Y235(24.10); Y238(23.55)  LDD3495  [4]
Jackson_14
 Probe Info  		2.27  LDD0123  [5]
5E-2FA
 Probe Info  		N.A.  LDD2235  [6]
NHS
 Probe Info  		N.A.  LDD0010  [7]
STPyne
 Probe Info  		K92(0.00); K108(0.00); K139(0.00)  LDD0009  [7]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [8]
Acrolein
 Probe Info  		H73(0.00); H70(0.00)  LDD0217  [9]
AOyne
 Probe Info  		15.00  LDD0443  [10]
PAL-AfBPP Probe
Click To Hide/Show 10 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C087
 Probe Info  		6.96  LDD1779  [11]
C094
 Probe Info  		60.97  LDD1785  [11]
C106
 Probe Info  		16.56  LDD1793  [11]
C198
 Probe Info  		9.58  LDD1874  [11]
C362
 Probe Info  		39.40  LDD2023  [11]
C363
 Probe Info  		19.43  LDD2024  [11]
C364
 Probe Info  		18.64  LDD2025  [11]
C366
 Probe Info  		6.63  LDD2027  [11]
C383
 Probe Info  		15.78  LDD2042  [11]
Alk-rapa
 Probe Info  		8.61  LDD0213  [12]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0156  Aniline NCI-H1299 15.00  LDD0403  [1]
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [9]
 LDCM0107  IAA HeLa H70(0.00); H73(0.00)  LDD0221  [9]
 LDCM0109  NEM HeLa H73(0.00); H70(0.00)  LDD0224  [9]
 LDCM0016  Ranjitkar_cp1 MDA-MB-231 2.27  LDD0123  [5]
 LDCM0090  Rapamycin JHH-7 8.61  LDD0213  [12]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Peptidyl-prolyl cis-trans isomerase F, mitochondrial (PPIF) Cyclophilin-type PPIase family P30405
Diacylglycerol O-acyltransferase 2-like protein 6 (DGAT2L6) Diacylglycerol acyltransferase family Q6ZPD8
Fatty acid desaturase 6 (FADS6) Fatty acid desaturase type 1 family Q8N9I5
ADP-ribosylation factor 6 (ARF6) Arf family P62330
Ras-related C3 botulinum toxin substrate 1 (RAC1) Rho family P63000
Ras-related C3 botulinum toxin substrate 2 (RAC2) Rho family P15153
Ras-related C3 botulinum toxin substrate 3 (RAC3) Rho family P60763
Rho-related GTP-binding protein Rho6 (RND1) Rho family Q92730
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
Fibronectin type III and SPRY domain-containing protein 2 (FSD2) . A1L4K1
Tripartite motif-containing protein 54 (TRIM54) . Q9BYV2
Transporter and channel
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Endophilin-B1 (SH3GLB1) Endophilin family Q9Y371
Huntingtin (HTT) Huntingtin family P42858
Nuclear pore glycoprotein p62 (NUP62) Nucleoporin NSP1/NUP62 family P37198
Secretory carrier-associated membrane protein 1 (SCAMP1) SCAMP family O15126
Secretory carrier-associated membrane protein 5 (SCAMP5) SCAMP family Q8TAC9
Synaptophysin (SYP) Synaptophysin/synaptobrevin family P08247
Transmembrane protein 255B (TMEM255B) TMEM255 family Q8WV15
Proteolipid protein 2 (PLP2) . Q04941
Syntenin-1 (SDCBP) . O00560
Transcription factor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Nuclear factor erythroid 2-related factor 2 (NFE2L2) BZIP family Q16236
Homeobox protein PKNOX2 (PKNOX2) TALE/MEIS homeobox family Q96KN3
DNA methyltransferase 1-associated protein 1 (DMAP1) . Q9NPF5
Other
Click To Hide/Show 21 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Biogenesis of lysosome-related organelles complex 1 subunit 2 (BLOC1S2) BLOC1S2 family Q6QNY1
Centrosomal protein of 63 kDa (CEP63) CEP63 family Q96MT8
Receptor expression-enhancing protein 5 (REEP5) DP1 family Q00765
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
HAUS augmin-like complex subunit 1 (HAUS1) HAUS1 family Q96CS2
Inhibitor of growth protein 5 (ING5) ING family Q8WYH8
Keratin, type I cytoskeletal 15 (KRT15) Intermediate filament family P19012
Keratin, type I cytoskeletal 16 (KRT16) Intermediate filament family P08779
Protein MAL2 (MAL2) MAL family Q969L2
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
Nuclear exosome regulator NRDE2 (NRDE2) NRDE2 family Q9H7Z3
Mitochondrial dynamics protein MIEF1 (MIEF1) SMCR7 family Q9NQG6
Nonsense-mediated mRNA decay factor SMG9 (SMG9) SMG9 family Q9H0W8
UPF0449 protein C19orf25 (C19orf25) UPF0449 family Q9UFG5
Alpha-tocopherol transfer protein (TTPA) . P49638
Arfaptin-1 (ARFIP1) . P53367
Arfaptin-2 (ARFIP2) . P53365
Centromere protein R (ITGB3BP) . Q13352
Cerebellar degeneration-related antigen 1 (CDR1) . P51861
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
Type-1 angiotensin II receptor-associated protein (AGTRAP) . Q6RW13

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
3 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
4 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
5 Appendage and Scaffold Diverse Fully Functionalized Small-Molecule Probes via a Minimalist Terminal Alkyne-Aliphatic Diazirine Isocyanide. J Org Chem. 2018 Sep 21;83(18):11245-11253. doi: 10.1021/acs.joc.8b01831. Epub 2018 Aug 31.
6 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
7 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
8 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
9 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
10 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
11 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
12 Rapamycin targets STAT3 and impacts c-Myc to suppress tumor growth. Cell Chem Biol. 2022 Mar 17;29(3):373-385.e6. doi: 10.1016/j.chembiol.2021.10.006. Epub 2021 Oct 26.