Details of the Target

General Information of Target

Target ID LDTP03384
Target Name Amine oxidase [flavin-containing] B (MAOB)
Gene Name MAOB
Gene ID 4129
Synonyms
Amine oxidase [flavin-containing] B; EC 1.4.3.21; EC 1.4.3.4; Monoamine oxidase type B; MAO-B
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR
TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ
TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY
YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER
LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT
FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV
Target Type
Successful
Target Bioclass
Enzyme
Family
Flavin monoamine oxidase family
Subcellular location
Mitochondrion outer membrane
Function
Catalyzes the oxidative deamination of primary and some secondary amines such as neurotransmitters, and exogenous amines including the tertiary amine, neurotoxin 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP), with concomitant reduction of oxygen to hydrogen peroxide and participates in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. Preferentially degrades benzylamine and phenylethylamine.
TTD ID
T83011
Uniprot ID
P27338
DrugMap ID
TTGP7BY
Ensemble ID
ENST00000378069.5
HGNC ID
HGNC:6834
ChEMBL ID
CHEMBL2039

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
DANG Substitution: p.F423_A424delinsLT .
HT115 Deletion: p.G13AfsTer16
SNV: p.V9M		 .
KMRC3 SNV: p.E385A .
NCIH358 Substitution: p.Y337_A338delinsTer .
NCIH82 SNV: p.P265L .
OVCAR8 SNV: p.E376D .
OVTOKO SNV: p.L246V .
PC9 Deletion: p.P304_R307del .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
YN-1
 Probe Info  		100.00  LDD0444  [1]
P11
 Probe Info  		20.00  LDD0201  [2]
Alkylaryl probe 3
 Probe Info  		20.00  LDD0282  [3]
DBIA
 Probe Info  		C365(1.16)  LDD0531  [4]
PAL-AfBPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STS-1
 Probe Info  		4.67  LDD0136  [5]
STS-2
 Probe Info  		1.67  LDD0138  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0214  AC1 HCT 116 C365(1.16)  LDD0531  [4]
 LDCM0216  AC100 HCT 116 C156(1.27)  LDD0533  [4]
 LDCM0217  AC101 HCT 116 C156(1.04)  LDD0534  [4]
 LDCM0218  AC102 HCT 116 C156(1.68)  LDD0535  [4]
 LDCM0219  AC103 HCT 116 C156(1.13)  LDD0536  [4]
 LDCM0220  AC104 HCT 116 C156(1.33)  LDD0537  [4]
 LDCM0221  AC105 HCT 116 C156(1.15)  LDD0538  [4]
 LDCM0222  AC106 HCT 116 C156(1.61)  LDD0539  [4]
 LDCM0223  AC107 HCT 116 C156(1.31)  LDD0540  [4]
 LDCM0224  AC108 HCT 116 C156(1.17)  LDD0541  [4]
 LDCM0225  AC109 HCT 116 C156(1.16)  LDD0542  [4]
 LDCM0227  AC110 HCT 116 C156(1.18)  LDD0544  [4]
 LDCM0228  AC111 HCT 116 C156(1.06)  LDD0545  [4]
 LDCM0229  AC112 HCT 116 C156(1.39)  LDD0546  [4]
 LDCM0230  AC113 HCT 116 C156(1.07)  LDD0547  [4]
 LDCM0231  AC114 HCT 116 C156(1.01)  LDD0548  [4]
 LDCM0232  AC115 HCT 116 C156(1.13)  LDD0549  [4]
 LDCM0233  AC116 HCT 116 C156(1.04)  LDD0550  [4]
 LDCM0234  AC117 HCT 116 C156(1.24)  LDD0551  [4]
 LDCM0235  AC118 HCT 116 C156(0.95)  LDD0552  [4]
 LDCM0236  AC119 HCT 116 C156(1.06)  LDD0553  [4]
 LDCM0238  AC120 HCT 116 C156(1.17)  LDD0555  [4]
 LDCM0239  AC121 HCT 116 C156(1.15)  LDD0556  [4]
 LDCM0240  AC122 HCT 116 C156(1.15)  LDD0557  [4]
 LDCM0241  AC123 HCT 116 C156(1.37)  LDD0558  [4]
 LDCM0242  AC124 HCT 116 C156(1.14)  LDD0559  [4]
 LDCM0243  AC125 HCT 116 C156(1.05)  LDD0560  [4]
 LDCM0244  AC126 HCT 116 C156(1.14)  LDD0561  [4]
 LDCM0245  AC127 HCT 116 C156(1.08)  LDD0562  [4]
 LDCM0263  AC143 HCT 116 C156(1.10); C365(1.13)  LDD0580  [4]
 LDCM0264  AC144 HCT 116 C365(1.01); C156(1.32)  LDD0581  [4]
 LDCM0265  AC145 HCT 116 C365(0.89); C156(1.02)  LDD0582  [4]
 LDCM0266  AC146 HCT 116 C156(1.08); C365(1.38)  LDD0583  [4]
 LDCM0267  AC147 HCT 116 C156(0.85); C365(0.85)  LDD0584  [4]
 LDCM0268  AC148 HCT 116 C156(0.78); C365(1.05)  LDD0585  [4]
 LDCM0269  AC149 HCT 116 C156(0.99); C365(1.40)  LDD0586  [4]
 LDCM0271  AC150 HCT 116 C156(1.03); C365(1.26)  LDD0588  [4]
 LDCM0272  AC151 HCT 116 C365(1.08); C156(1.21)  LDD0589  [4]
 LDCM0273  AC152 HCT 116 C156(1.18); C365(1.27)  LDD0590  [4]
 LDCM0274  AC153 HCT 116 C156(1.18); C365(1.46)  LDD0591  [4]
 LDCM0621  AC154 HCT 116 C156(1.13); C365(1.21)  LDD2158  [4]
 LDCM0622  AC155 HCT 116 C156(1.17); C365(1.32)  LDD2159  [4]
 LDCM0623  AC156 HCT 116 C156(1.17); C365(1.49)  LDD2160  [4]
 LDCM0624  AC157 HCT 116 C156(1.13); C365(1.29)  LDD2161  [4]
 LDCM0276  AC17 HCT 116 C365(1.12)  LDD0593  [4]
 LDCM0277  AC18 HCT 116 C365(0.99)  LDD0594  [4]
 LDCM0278  AC19 HCT 116 C365(0.99)  LDD0595  [4]
 LDCM0279  AC2 HCT 116 C365(1.33)  LDD0596  [4]
 LDCM0280  AC20 HCT 116 C365(1.01)  LDD0597  [4]
 LDCM0281  AC21 HCT 116 C365(1.09)  LDD0598  [4]
 LDCM0282  AC22 HCT 116 C365(0.97)  LDD0599  [4]
 LDCM0283  AC23 HCT 116 C365(0.95)  LDD0600  [4]
 LDCM0284  AC24 HCT 116 C365(0.99)  LDD0601  [4]
 LDCM0290  AC3 HCT 116 C365(1.32)  LDD0607  [4]
 LDCM0296  AC35 HCT 116 C365(0.92); C156(1.20)  LDD0613  [4]
 LDCM0297  AC36 HCT 116 C365(0.84); C156(1.17)  LDD0614  [4]
 LDCM0298  AC37 HCT 116 C365(0.89); C156(1.22)  LDD0615  [4]
 LDCM0299  AC38 HCT 116 C365(0.95); C156(1.25)  LDD0616  [4]
 LDCM0300  AC39 HCT 116 C365(0.89); C156(1.11)  LDD0617  [4]
 LDCM0301  AC4 HCT 116 C365(1.38)  LDD0618  [4]
 LDCM0302  AC40 HCT 116 C365(0.90); C156(1.11)  LDD0619  [4]
 LDCM0303  AC41 HCT 116 C365(0.86); C156(1.06)  LDD0620  [4]
 LDCM0304  AC42 HCT 116 C365(0.86); C156(0.92)  LDD0621  [4]
 LDCM0305  AC43 HCT 116 C365(0.73); C156(0.82)  LDD0622  [4]
 LDCM0306  AC44 HCT 116 C156(0.85); C365(0.98)  LDD0623  [4]
 LDCM0307  AC45 HCT 116 C365(0.90); C156(0.90)  LDD0624  [4]
 LDCM0312  AC5 HCT 116 C365(1.33)  LDD0629  [4]
 LDCM0332  AC68 HCT 116 C365(0.81)  LDD0649  [4]
 LDCM0333  AC69 HCT 116 C365(0.95)  LDD0650  [4]
 LDCM0335  AC70 HCT 116 C365(1.19)  LDD0652  [4]
 LDCM0336  AC71 HCT 116 C365(1.11)  LDD0653  [4]
 LDCM0337  AC72 HCT 116 C365(0.92)  LDD0654  [4]
 LDCM0338  AC73 HCT 116 C365(0.56)  LDD0655  [4]
 LDCM0339  AC74 HCT 116 C365(0.53)  LDD0656  [4]
 LDCM0340  AC75 HCT 116 C365(0.41)  LDD0657  [4]
 LDCM0341  AC76 HCT 116 C365(0.97)  LDD0658  [4]
 LDCM0342  AC77 HCT 116 C365(1.16)  LDD0659  [4]
 LDCM0343  AC78 HCT 116 C365(1.23)  LDD0660  [4]
 LDCM0344  AC79 HCT 116 C365(1.19)  LDD0661  [4]
 LDCM0346  AC80 HCT 116 C365(1.00)  LDD0663  [4]
 LDCM0347  AC81 HCT 116 C365(1.07)  LDD0664  [4]
 LDCM0348  AC82 HCT 116 C365(0.25)  LDD0665  [4]
 LDCM0365  AC98 HCT 116 C156(0.98)  LDD0682  [4]
 LDCM0366  AC99 HCT 116 C156(1.23)  LDD0683  [4]
 LDCM0088  C45 HEK-293T 20.00  LDD0201  [2]
 LDCM0367  CL1 HCT 116 C365(1.01)  LDD0684  [4]
 LDCM0368  CL10 HCT 116 C365(0.69)  LDD0685  [4]
 LDCM0369  CL100 HCT 116 C365(1.18)  LDD0686  [4]
 LDCM0374  CL105 HCT 116 C365(1.22)  LDD0691  [4]
 LDCM0375  CL106 HCT 116 C365(1.07)  LDD0692  [4]
 LDCM0376  CL107 HCT 116 C365(1.07)  LDD0693  [4]
 LDCM0377  CL108 HCT 116 C365(1.07)  LDD0694  [4]
 LDCM0378  CL109 HCT 116 C365(1.02)  LDD0695  [4]
 LDCM0379  CL11 HCT 116 C365(0.67)  LDD0696  [4]
 LDCM0380  CL110 HCT 116 C365(0.99)  LDD0697  [4]
 LDCM0381  CL111 HCT 116 C365(0.96)  LDD0698  [4]
 LDCM0387  CL117 HCT 116 C156(0.52); C365(0.88)  LDD0704  [4]
 LDCM0388  CL118 HCT 116 C156(0.67); C365(0.92)  LDD0705  [4]
 LDCM0389  CL119 HCT 116 C365(0.88); C156(0.90)  LDD0706  [4]
 LDCM0390  CL12 HCT 116 C365(0.77)  LDD0707  [4]
 LDCM0391  CL120 HCT 116 C365(0.79); C156(1.06)  LDD0708  [4]
 LDCM0400  CL13 HCT 116 C365(0.85)  LDD0717  [4]
 LDCM0401  CL14 HCT 116 C365(0.90)  LDD0718  [4]
 LDCM0402  CL15 HCT 116 C365(0.39)  LDD0719  [4]
 LDCM0403  CL16 HCT 116 C365(0.89)  LDD0720  [4]
 LDCM0404  CL17 HCT 116 C365(0.81)  LDD0721  [4]
 LDCM0405  CL18 HCT 116 C365(1.28)  LDD0722  [4]
 LDCM0406  CL19 HCT 116 C365(1.05)  LDD0723  [4]
 LDCM0407  CL2 HCT 116 C365(1.12)  LDD0724  [4]
 LDCM0408  CL20 HCT 116 C365(0.81)  LDD0725  [4]
 LDCM0409  CL21 HCT 116 C365(0.83)  LDD0726  [4]
 LDCM0410  CL22 HCT 116 C365(0.51)  LDD0727  [4]
 LDCM0411  CL23 HCT 116 C365(0.74)  LDD0728  [4]
 LDCM0412  CL24 HCT 116 C365(0.99)  LDD0729  [4]
 LDCM0413  CL25 HCT 116 C365(1.18)  LDD0730  [4]
 LDCM0414  CL26 HCT 116 C365(0.85)  LDD0731  [4]
 LDCM0415  CL27 HCT 116 C365(0.92)  LDD0732  [4]
 LDCM0416  CL28 HCT 116 C365(0.77)  LDD0733  [4]
 LDCM0417  CL29 HCT 116 C365(0.91)  LDD0734  [4]
 LDCM0418  CL3 HCT 116 C365(0.86)  LDD0735  [4]
 LDCM0419  CL30 HCT 116 C365(1.08)  LDD0736  [4]
 LDCM0420  CL31 HCT 116 C365(0.72)  LDD0737  [4]
 LDCM0421  CL32 HCT 116 C365(1.01)  LDD0738  [4]
 LDCM0422  CL33 HCT 116 C365(0.68)  LDD0739  [4]
 LDCM0423  CL34 HCT 116 C365(0.46)  LDD0740  [4]
 LDCM0424  CL35 HCT 116 C365(0.54)  LDD0741  [4]
 LDCM0425  CL36 HCT 116 C365(0.55)  LDD0742  [4]
 LDCM0426  CL37 HCT 116 C365(0.49)  LDD0743  [4]
 LDCM0428  CL39 HCT 116 C365(0.53)  LDD0745  [4]
 LDCM0429  CL4 HCT 116 C365(0.99)  LDD0746  [4]
 LDCM0430  CL40 HCT 116 C365(0.59)  LDD0747  [4]
 LDCM0431  CL41 HCT 116 C365(0.54)  LDD0748  [4]
 LDCM0432  CL42 HCT 116 C365(0.24)  LDD0749  [4]
 LDCM0433  CL43 HCT 116 C365(0.43)  LDD0750  [4]
 LDCM0434  CL44 HCT 116 C365(0.59)  LDD0751  [4]
 LDCM0435  CL45 HCT 116 C365(0.45)  LDD0752  [4]
 LDCM0440  CL5 HCT 116 C365(0.87)  LDD0757  [4]
 LDCM0451  CL6 HCT 116 C365(0.95)  LDD0768  [4]
 LDCM0453  CL61 HCT 116 C365(0.94)  LDD0770  [4]
 LDCM0454  CL62 HCT 116 C365(0.93)  LDD0771  [4]
 LDCM0455  CL63 HCT 116 C365(0.91)  LDD0772  [4]
 LDCM0456  CL64 HCT 116 C365(0.59)  LDD0773  [4]
 LDCM0457  CL65 HCT 116 C365(0.90)  LDD0774  [4]
 LDCM0458  CL66 HCT 116 C365(0.71)  LDD0775  [4]
 LDCM0459  CL67 HCT 116 C365(0.75)  LDD0776  [4]
 LDCM0460  CL68 HCT 116 C365(0.83)  LDD0777  [4]
 LDCM0461  CL69 HCT 116 C365(1.16)  LDD0778  [4]
 LDCM0462  CL7 HCT 116 C365(0.75)  LDD0779  [4]
 LDCM0463  CL70 HCT 116 C365(0.89)  LDD0780  [4]
 LDCM0464  CL71 HCT 116 C365(0.73)  LDD0781  [4]
 LDCM0465  CL72 HCT 116 C365(0.94)  LDD0782  [4]
 LDCM0466  CL73 HCT 116 C365(0.75)  LDD0783  [4]
 LDCM0467  CL74 HCT 116 C365(0.80)  LDD0784  [4]
 LDCM0469  CL76 HCT 116 C365(0.91)  LDD0786  [4]
 LDCM0470  CL77 HCT 116 C365(0.66)  LDD0787  [4]
 LDCM0471  CL78 HCT 116 C365(0.88)  LDD0788  [4]
 LDCM0472  CL79 HCT 116 C365(0.90)  LDD0789  [4]
 LDCM0473  CL8 HCT 116 C365(0.73)  LDD0790  [4]
 LDCM0474  CL80 HCT 116 C365(1.26)  LDD0791  [4]
 LDCM0475  CL81 HCT 116 C365(0.92)  LDD0792  [4]
 LDCM0476  CL82 HCT 116 C365(0.92)  LDD0793  [4]
 LDCM0477  CL83 HCT 116 C365(1.02)  LDD0794  [4]
 LDCM0478  CL84 HCT 116 C365(0.76)  LDD0795  [4]
 LDCM0479  CL85 HCT 116 C365(0.86)  LDD0796  [4]
 LDCM0480  CL86 HCT 116 C365(0.90)  LDD0797  [4]
 LDCM0481  CL87 HCT 116 C365(0.82)  LDD0798  [4]
 LDCM0482  CL88 HCT 116 C365(0.85)  LDD0799  [4]
 LDCM0483  CL89 HCT 116 C365(0.69)  LDD0800  [4]
 LDCM0484  CL9 HCT 116 C365(0.85)  LDD0801  [4]
 LDCM0485  CL90 HCT 116 C365(0.78)  LDD0802  [4]
 LDCM0486  CL91 HCT 116 C365(0.78)  LDD0803  [4]
 LDCM0487  CL92 HCT 116 C365(0.92)  LDD0804  [4]
 LDCM0488  CL93 HCT 116 C365(1.09)  LDD0805  [4]
 LDCM0489  CL94 HCT 116 C365(1.23)  LDD0806  [4]
 LDCM0490  CL95 HCT 116 C365(0.91)  LDD0807  [4]
 LDCM0491  CL96 HCT 116 C365(1.20)  LDD0808  [4]
 LDCM0492  CL97 HCT 116 C365(0.94)  LDD0809  [4]
 LDCM0493  CL98 HCT 116 C365(1.15)  LDD0810  [4]
 LDCM0494  CL99 HCT 116 C365(1.32)  LDD0811  [4]
 LDCM0468  Fragment33 HCT 116 C365(0.87)  LDD0785  [4]
 LDCM0427  Fragment51 HCT 116 C365(0.34)  LDD0744  [4]
 LDCM0022  KB02 22RV1 C68(1.87)  LDD2243  [6]
 LDCM0023  KB03 769-P C365(2.80); C156(2.77)  LDD2663  [6]
 LDCM0024  KB05 COLO792 C68(1.70)  LDD3310  [6]
 LDCM0099  Phenelzine HEK-293T 20.00  LDD0282  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Amine oxidase [flavin-containing] A (MAOA) Flavin monoamine oxidase family P21397
Caspase-6 (CASP6) Peptidase C14A family P55212
Atypical kinase COQ8A, mitochondrial (COQ8A) ADCK protein kinase family Q8NI60
Fibroblast growth factor receptor 3 (FGFR3) Tyr protein kinase family P22607
GTP-binding nuclear protein Ran (RAN) Ran family P62826
GTPase HRas (HRAS) Ras family P01112
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cytochrome c oxidase assembly protein COX20, mitochondrial (COX20) COX20 family Q5RI15
Endophilin-B1 (SH3GLB1) Endophilin family Q9Y371
mRNA export factor GLE1 (GLE1) GLE1 family Q53GS7
Nucleoporin p58/p45 (NUP58) NUP58 family Q9BVL2
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Krueppel-like factor 11 (KLF11) Sp1 C2H2-type zinc-finger protein family O14901
Other
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Gelsolin (GSN) Villin/gelsolin family P06396
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) . Q7Z699
Ubiquilin-1 (UBQLN1) . Q9UMX0

The Drug(s) Related To This Target

Approved
Click To Hide/Show 36 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Amantadine Small molecular drug DB00915
Amphetamine Small molecular drug DB00182
Betahistine Small molecular drug DB06698
Budipine Small molecular drug D0RM9Q
Dopamine Small molecular drug DB00988
Epinephrine Small molecular drug DB00668
Escitalopram Small molecular drug DB01175
Flavin Adenine Dinucleotide Small molecular drug DB03147
Indeloxazine Small molecular drug D07TGY
Isocarboxazid Small molecular drug DB01247
Metamfetamine Small molecular drug DB01577
Moclobemide Small molecular drug DB01171
Nandrolone Decanoate Small molecular drug DB08804
Nicotine Small molecular drug DB00184
Nomifensine Small molecular drug DB04821
Pargyline Small molecular drug D0R0UJ
Phenelzine Small molecular drug D0P9AC
Phentermine Small molecular drug DB00191
Phenylephrine Small molecular drug DB00388
Pioglitazone Small molecular drug DB01132
Procaine Small molecular drug DB00721
Rasagiline Small molecular drug D06OMW
Safinamide Small molecular drug D0TV6I
Selegiline Small molecular drug D0S2UG
Selegiline Hydrochloride Small molecular drug D0J2MJ
Sertraline Small molecular drug DB01104
Sulphadoxine Small molecular drug D07PAO
Tranylcypromine Small molecular drug D0H0HJ
Zimelidine Small molecular drug DB04832
Zonisamide Small molecular drug DB00909
Copper . DB09130
Flortaucipir F-18 . DB14914
Nialamide . DB04820
Ozanimod . DB12612
Safinamide Mesylate . D0XM1A
Viloxazine . DB09185
Phase 3
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Psoralen Small molecular drug D00VUI
Tryptamine Small molecular drug D08CJK
P2b-001 . D01NKW
Phase 2
Click To Hide/Show 6 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Chf-3381 Small molecular drug D04RCT
Ladostigil Small molecular drug D0C3UC
Piperine Small molecular drug D0H7PW
Evt302 . D06PHS
Neu-120 . D0D1UQ
Rg1577 . D02PSS
Phase 1
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Pf9601n Small molecular drug D0W7LO
Preclinical
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Rwj-416457 Small molecular drug D0I9LO
Investigative
Click To Hide/Show 252 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
(+/-)-2-(4'-benzyloxyphenyl)Thiomorpholin-5-one Small molecular drug D0T3ZS
(+/-)-2-(4'-benzyloxyphenyl)Thiomorpholine Small molecular drug D0D6OR
(+/-)-2-(4'-butoxyphenyl)Thiomorpholin-5-one Small molecular drug D0M4GR
(+/-)-2-(4'-butoxyphenyl)Thiomorpholine Small molecular drug D0T3XC
(+/-)-2-(4'-ethoxyphenyl)Thiomorpholin-5-one Small molecular drug D0D5KD
(+/-)-2-(4'-ethoxyphenyl)Thiomorpholine Small molecular drug D0J0QW
(+/-)-2-(4'-methoxyphenyl)Thiomorpholin-5-one Small molecular drug D0ID3Y
(+/-)-2-(4'-methoxyphenyl)Thiomorpholine Small molecular drug D08TFN
(+/-)-2-(4'-propoxyphenyl)Thiomorpholin-5-one Small molecular drug D0Z5BU
(+/-)-2-(4'-propoxyphenyl)Thiomorpholine Small molecular drug D08FXH
(+/-)-2-(4-fluorophenyl)-7-methoxychroman-4-one Small molecular drug D0B1XZ
(+/-)-2-(4-fluorophenyl)-7-methylchroman-4-one Small molecular drug D04DCW
(+/-)-2-(4-fluorophenyl)Chroman-4-one Small molecular drug D0ZH0T
(+/-)-2-(4-methoxyphenyl)-7-methylchroman-4-one Small molecular drug D0O0MY
(+/-)-2-p-tolylchroman-4-one Small molecular drug D0R3LP
(+/-)-2-phenylthiomorpholin-5-one Small molecular drug D04FLL
(+/-)-2-phenylthiomorpholine Small molecular drug D0HU4J
(+/-)-7-fluoro-2-(4-fluorophenyl)Chroman-4-one Small molecular drug D0D2JH
(+/-)-7-fluoro-2-(4-methoxyphenyl)Chroman-4-one Small molecular drug D03XQB
(+/-)-7-fluoro-2-p-tolylchroman-4-one Small molecular drug D0Y0KU
(+/-)-7-fluoro-2-phenylchroman-4-one Small molecular drug D0IK2S
(+/-)-7-methoxy-2-p-tolylchroman-4-one Small molecular drug D02KXU
(+/-)-7-methyl-2-p-tolylchroman-4-one Small molecular drug D0Z2XR
(+/-)-7-methyl-2-phenylchroman-4-one Small molecular drug D0T1GP
(6-benzyloxy-2-naphthyl)-2-aminopropane Small molecular drug D03HXD
(6-ethoxy-2-naphthyl)-2-aminopropane Small molecular drug D0L5EW
(6-methoxy-2-naphthyl)-2-aminopropane Small molecular drug D02IDM
(6-propoxy-2-naphthyl)-2-aminopropane Small molecular drug D0IP7L
(7-benzyloxy-2-oxo-2h-chromen-4-yl)Acetonitrile Small molecular drug D02TFD
(E)-5-(3-chlorostyryl)Isatin Small molecular drug D06AJP
(E)-5-(3-fluorostyryl)Isatin Small molecular drug D0X8HH
(E)-5-styrylisatin Small molecular drug D09XSB
(E)-6-styrylisatin Small molecular drug D07GUX
(E)-8-(3-chlorostyryl)-caffeine Small molecular drug D0TU7I
(R)(+)-2-(4-fluorophenyl)-7-methoxychroman-4-one Small molecular drug D0F2SM
(R)(+)-7-fluoro-2-(4-fluorophenyl)Chroman-4-one Small molecular drug D07WIJ
(R)(+)-7-fluoro-2-p-tolylchroman-4-one Small molecular drug D02WOQ
(R)(+)-7-fluoro-2-phenylchroman-4-one Small molecular drug D09PBW
(R)(+)-7-methyl-2-p-tolylchroman-4-one Small molecular drug D0P1YC
(R)(+)-7-methyl-2-phenylchroman-4-one Small molecular drug D0B3QN
(R)-3-prop-2-ynylamino-indan-5-ol Small molecular drug D07BAO
(R)-n-methyl-n-2-propynyl-1-indanamine Small molecular drug DB02211
(R)-n2-{4-[(3-chlorobenzyl)Oxy]Benzyl}Alaninamide Small molecular drug D0JY9B
(R)-n2-{4-[(3-chlorobenzyl)Oxy]Benzyl}Serinamide Small molecular drug D05ILO
(R)-n2-{4-[(3-fluorobenzyl)Oxy]Benzyl}Alaninamide Small molecular drug D05HVV
(R/R)Befloxatone Small molecular drug D0M0XR
(S)(+)-2-(4-fluorophenyl)-7-methoxychroman-4-one Small molecular drug D01KZF
(S)(+)-7-fluoro-2-(4-fluorophenyl)Chroman-4-one Small molecular drug D0L6HE
(S)(+)-7-fluoro-2-p-tolylchroman-4-one Small molecular drug D00PJT
(S)(+)-7-fluoro-2-phenylchroman-4-one Small molecular drug D0I5CZ
(S)(+)-7-methyl-2-p-tolylchroman-4-one Small molecular drug D0TB1E
(S)(+)-7-methyl-2-phenylchroman-4-one Small molecular drug D0N4DR
(S)-2-amino-1-(4-butylthiophenyl)-propane Small molecular drug D0Z0ZU
(S)-2-amino-1-(4-propylthiophenyl)-propane Small molecular drug D08SSS
(S)-n2-[4-(Benzyloxy)Benzyl]Alaninamide Small molecular drug D05OTR
(S)-n2-[4-(Benzyloxy)Benzyl]Serinamide Small molecular drug D0U4JD
(S)-n2-{4-[(3-chlorobenzyl)Oxy]Benzyl}Alaninamide Small molecular drug D03KYZ
(S)-n2-{4-[(3-chlorobenzyl)Oxy]Benzyl}Serinamide Small molecular drug D0FR3X
(S)-n2-{4-[(3-fluorobenzyl)Oxy]Benzyl}Serinamide Small molecular drug D0IN0X
(S)-n2-{4-[(4-chlorobenzyl)Oxy]Benzyl}Alaninamide Small molecular drug D0G5YA
(S)-n2-{4-[(4-chlorobenzyl)Oxy]Benzyl}Serinamide Small molecular drug D0T8AD
(S)-n2-{4-[(4-nitrobenzyl)Oxy]Benzyl}Serinamide Small molecular drug D09GCE
1,2,3,4-tetrahydro-naphthalen-1-ylamine Small molecular drug D0UF1R
1,2,3,4-tetrahydro-pyrazino[1,2-a]Indole Small molecular drug D0C1SE
1,4-diphenyl-(1e,3e)-1,3-butadiene Small molecular drug D0J0MX
1-(4-(Benzyloxy)Phenyl)Propan-2-amine Small molecular drug D01SBZ
1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine Small molecular drug D01GAX
1h-indole-2,3-dione Small molecular drug D0SP2O
2,3,4,5-tetrahydro-1h-pyrido[4,3-b]Indole Small molecular drug D0M7WE
2-(2,4-dichlorophenyl)-4,5-dihydro-1h-imidazole Small molecular drug D0Q3VS
2-(2-cycloheptylidenehydrazinyl)-4-phenylthiazole Small molecular drug D0Q1IP
2-(2-cyclohexylidenehydrazinyl)-4-p-tolylthiazole Small molecular drug D0I2GP
2-(2-cyclohexylidenehydrazinyl)-4-phenylthiazole Small molecular drug D0E4HB
2-(2-cyclopentylidenehydrazinyl)-4-phenylthiazole Small molecular drug D00WVG
2-(3-nitrophenyl)-4,5-dihydro-1h-imidazole Small molecular drug D07YZD
2-(4,5-dihydro-1h-imidazol-2-yl)Quinoline Small molecular drug D0A4AB
2-(4-chlorophenyl)-4,5-dihydro-1h-imidazole Small molecular drug D01FTB
2-(4-fluorophenyl)-7-methoxy-4h-chromen-4-one Small molecular drug D0G6MA
2-(4-methoxyphenyl)-4h-chromene-4-thione Small molecular drug D0P7SY
2-(5-phenyl-furan-2-yl)-4,5-dihydro-1h-imidazole Small molecular drug D0P1UC
2-(Naphthalen-2-yl)-4,5-dihydro-1h-imidazole Small molecular drug D04ZPU
2-bfi Small molecular drug D0LI3J
2-bromo-n-(2-morpholinoethyl)Nicotinamide Small molecular drug D02BBT
2-bromo-n-(3-morpholinopropyl)Nicotinamide Small molecular drug D01JMW
2-chloro-n-(2-morpholinoethyl)Nicotinamide Small molecular drug D0R5EW
2-chloro-n-(3-morpholinopropyl)Nicotinamide Small molecular drug D0NS9X
2-furan-2-yl-4,5-dihydro-1h-imidazole Small molecular drug D09ZDQ
2-hydrazino-3-methyl-4(3h)-quinazolinone Small molecular drug D02VIV
2-methyl-9h-indeno[2,1-d]Pyrimidin-9-one Small molecular drug D0FH5A
2-oxo-n-m-tolyl-2h-chromene-3-carboxamide Small molecular drug D00WSM
2-oxo-n-p-tolyl-2h-chromene-3-carboxamide Small molecular drug D0H0GZ
2-oxo-n-phenyl-2h-chromene-3-carboxamide Small molecular drug D03PXS
2-p-tolyl-4h-chromen-4-one Small molecular drug D03BQJ
2-p-tolyl-4h-chromene-4-thione Small molecular drug D01VPZ
2-phenethyl-4,5-dihydro-1h-imidazole Small molecular drug D0Z7NC
2-phenoxymethyl-4,5-dihydro-1h-imidazole Small molecular drug D0N9FH
2-phenyl-9h-indeno[2,1-d]Pyrimidine Small molecular drug D0Q9NC
2-[7-(Benzyloxy)-2-oxo-2h-chromen-4-yl]Acetamide Small molecular drug D0S3QN
3,4-benzo-7-(Beta-bromoallyloxy)-8-methylcoumarin Small molecular drug D0P4GF
3,4-benzo-7-acetonyloxy-8-methoxycoumarin Small molecular drug D0TL3S
3,4-dichloro-n-(2-methyl-1h-indol-5-yl)Benzamide Small molecular drug D09NNZ
3-(2-bromophenyl)-6-methylcoumarin Small molecular drug D0U8ET
3-(3-methoxyphenyl)-6-methyl-2h-chromen-2-one Small molecular drug D0O1GE
3-(4-hydroxyphenyl)-6-methyl-2h-chromen-2-one Small molecular drug D01HQV
3-(4-methoxyphenyl)-6-methyl-2h-chromen-2-one Small molecular drug D0R9TX
3-(Phenoxymethyl)-5h-indeno[1,2-c]Pyridazin-5-one Small molecular drug D0I6GH
3-chloro-n-(2-methyl-1h-indol-5-yl)Benzamide Small molecular drug D0D6QI
3-phenyl-9h-indeno[1,2-e][1,2,4]Triazin-9-one Small molecular drug D08IDJ
4,8-dimethyl-7-(2'-oxocyclohexyloxy)Coumarin Small molecular drug D01LUB
4,9-dihydro-3h-beta-carboline Small molecular drug D0G8BT
4-(2-oxo-2h-chromene-3-carboxamido)Benzoic Acid Small molecular drug D0E8IE
4-(Aminomethyl)-7-(Benzyloxy)-2h-chromen-2-one Small molecular drug D0T1FJ
4-hydroxy-n-propargyl-1(R)-aminoindan Small molecular drug D06ETG
4-methyl-7-(2-oxocyclopentyloxy)-2h-chromen-2-one Small molecular drug D0A1RE
4-oxo-4h-chromene-3-carboxylic Acid Small molecular drug D04TGN
4-phenyl-1,2,3,6-tetrahydropyridine Small molecular drug D07AAZ
5-aminomethyl-3-pyrrol-1-yl-oxazolidin-2-one Small molecular drug D0R7UO
5-bromo-2,3,4,9-tetrahydro-1h-beta-carboline Small molecular drug D0L8ND
5-bromo-4,9-dihydro-3h-beta-carboline Small molecular drug D08HAM
5-hydroxy-n-propargyl-1(R)-aminoindan Small molecular drug DB04307
5-hydroxymethyl-3-pyrrol-1-yl-oxazolidin-2-one Small molecular drug D08QVY
5-methoxy-2,3,4,9-tetrahydro-1h-beta-carboline Small molecular drug D00NSA
5-methoxy-4,9-dihydro-3h-beta-carboline Small molecular drug D0V6XA
5-quinoxalin-6-ylmethylene-thiazolidine-2,4-dione Small molecular drug D08NQM
6-amino-9-methoxy-7h-furo[3,2-g]Chromen-7-one Small molecular drug D0S0JH
6-bromo-2,3,4,9-tetrahydro-1h-beta-carboline Small molecular drug D05GQQ
6-bromo-4,9-dihydro-3h-beta-carboline Small molecular drug D04GVX
6-methoxy-2,3,4,9-tetrahydro-1h-beta-carboline Small molecular drug D0J3SN
6-methoxy-4,9-dihydro-3h-beta-carboline Small molecular drug D0C7PD
7-(3-chlorobenzyloxy)-4-carboxaldehyde-coumarin Small molecular drug D0C9WW
7-acetonyloxy-3,4-cyclohexene-8-methylcoumarin Small molecular drug D08FFH
7-acetonyloxy-3,4-cyclopentene-8-methylcoumarin Small molecular drug D00OQL
7-bromo-2,3,4,9-tetrahydro-1h-beta-carboline Small molecular drug D02UVG
7-bromo-4,9-dihydro-3h-beta-carboline Small molecular drug D0W4TW
7-fluoro-2-(4-fluorophenyl)-4h-chromene-4-thione Small molecular drug D0Y5OB
7-fluoro-2-(4-methoxyphenyl)-4h-chromen-4-one Small molecular drug D0W7XK
7-fluoro-2-p-tolyl-4h-chromen-4-one Small molecular drug D0C9GI
7-fluoro-2-p-tolyl-4h-chromene-4-thione Small molecular drug D0I9AA
7-methoxy-2,3,4,9-tetrahydro-1h-beta-carboline Small molecular drug D05GDP
7-methoxy-2-p-tolyl-4h-chromen-4-one Small molecular drug D0ZI0S
7-methoxy-2-p-tolyl-4h-chromene-4-thione Small molecular drug D07HFF
7-methoxy-9h-beta-carboline Small molecular drug D05FQN
7-methyl-2-p-tolyl-4h-chromene-4-thione Small molecular drug D08HKC
7-[(3-chlorobenzyl)Oxy]-2-oxo-2h-chromene-4-carbaldehyde Small molecular drug DB07512
8-(3-bromobenzyloxy)Caffeine Small molecular drug D07NBB
8-(3-chlorobenzyloxy)Caffeine Small molecular drug D08YCE
8-(3-fluorobenzyloxy)Caffeine Small molecular drug D04LPY
8-(3-methoxybenzyloxy)Caffeine Small molecular drug D0B6MV
8-(3-methylbenzyloxy)Caffeine Small molecular drug D00OLX
8-benzyloxycaffeine Small molecular drug D0JN9R
8-bromo-2,3,4,9-tetrahydro-1h-beta-carboline Small molecular drug D06BAC
8-bromo-4,9-dihydro-3h-beta-carboline Small molecular drug D0G2EF
8-bromo-6-methyl-3-(4'-methoxyphenyl)Coumarin Small molecular drug D0H3RQ
8-bromo-6-methyl-3-phenylcoumarin Small molecular drug D0K1FE
8-methoxy-2,3,4,9-tetrahydro-1h-beta-carboline Small molecular drug D0Q3VI
8-methoxy-4,9-dihydro-3h-beta-carboline Small molecular drug D0Y1GL
8-[(3-trifluoromethyl)Benzyloxy]Caffeine Small molecular drug D02FJX
9-methyl-2,3,4,9-tetrahydro-1h-beta-carboline Small molecular drug D0D2YR
Benzyl-methyl-[1-(1h-pyrrol-2-yl)-vinyl]-amine Small molecular drug D0Y0JM
Beta-methoxyamphetamine Small molecular drug D0R7ZC
Bicifadine Small molecular drug DB04889
C-(1h-indol-3-yl)-methylamine Small molecular drug D05FMZ
Cgs-19281a Small molecular drug D0D1PE
Chalcone Small molecular drug D06ERH
Cis-2-(4-chlorophenyl)-2-fluorocyclopropanamine Small molecular drug D06AAA
Cis-2-(Para-fluorophenyl)Cyclopropylamine Small molecular drug D0UL6Y
Cis-2-fluoro-2-(4-methoxyphenyl)Cyclopropylamine Small molecular drug D0B2TV
Cis-2-fluoro-2-phenylcyclopropanamine Small molecular drug D04TZI
Cis-2-phenylcyclopropylamine Small molecular drug D0X8RN
Cordoin Small molecular drug D0US0J
Deprenyl Small molecular drug D0Y8AN
Dodecyldimethylamine N-oxide Small molecular drug DB04147
Ephedra Sinica Root Small molecular drug DB01363
Farnesol Small molecular drug D0M0CF
Flavanone Small molecular drug D0B4VE
Flavin-adenine Dinucleotide Small molecular drug D00IMW
Hydrazinecarboxamide Small molecular drug D0A4IY
Iproniazide Small molecular drug D08CNS
Isatin Small molecular drug DB02095
L-136662 Small molecular drug D0F7KG
Lauryl Dimethylamine-n-oxide Small molecular drug D0C7PY
Lu-53439 Small molecular drug D0BV8Y
Methyl Piperate Small molecular drug D0EX4L
Methyl-(1,2,3,4-tetrahydro-naphthalen-1-yl)-amine Small molecular drug D0MX1T
Mmda Small molecular drug D0I4ME
N-(1h-indol-2-ylmethyl)-n-methyl-n-phenylamine Small molecular drug D00KDZ
N-(1h-indol-2-ylmethyl)-n-phenylamine Small molecular drug D01PES
N-(2-aminoethyl)-2-oxo-2h-chromene-3-carboxamide Small molecular drug D02KGZ
N-(2-methyl-1h-indol-5-yl)Benzamide Small molecular drug D08ILX
N-(2-methyl-1h-indol-5-yl)Cyclohexanecarboxamide Small molecular drug D05WQN
N-(2-phenylethyl),N-(Pyrrol-2-ylmethyl)Amine Small molecular drug D0N8UE
N-(2-phenylethyl)-1h-indole-2-carboxamide Small molecular drug D0YO7C
N-(3-phenylpropyl)-1h-indole-2-carboxamide Small molecular drug D07LCU
N-(4-ethylphenyl)-2-oxo-2h-chromene-3-carboxamide Small molecular drug D0B1WD
N-(4-phenylbutyl)-1h-indole-2-carboxamide Small molecular drug D08HNJ
N-(Benzyl),N-(Pyrrol-2-ylmethyl)Amine Small molecular drug D0O2UK
N-(Propargyl),N-(Pyrrol-2-ylmethyl)Amine Small molecular drug D0G4BG
N-benzyl,N-methyl-1h-indole-2-carboxamide Small molecular drug D0V0TN
N-benzyl-1h-indole-2-carboxamide Small molecular drug D0Z5YO
N-benzyl-2-oxo-2h-chromene-3-carboxamide Small molecular drug D06QNN
N-benzyl-n-(1h-indol-2-ylmethyl)-n-methylamine Small molecular drug D05ANK
N-cyclohexyl-2-oxo-2h-chromene-3-carboxamide Small molecular drug D01UFM
N-isobutyl-2-oxo-2h-chromene-3-carboxamide Small molecular drug D09FAD
N-methyl,N-(Benzyl),N-(Pyrrol-2-ylmethyl)Amine Small molecular drug D0MO1O
N-methyl,N-(Propargyl),N-(Pyrrol-2-ylmethyl)Amine Small molecular drug D03KDD
N-methyl,N-phenyl-1h-indole-2-carboxamide Small molecular drug D0F7JK
N-methyl-n-phenyl-2-oxo-2h-chromene-3-carboxamide Small molecular drug D0W1WE
N-methyl-n-propargyl-1(R)-aminoindan Small molecular drug D0A2AF
N-phenyl-1h-indole-2-carboxamide Small molecular drug D0K9UN
N-propargyl-1(S)-aminoindan Small molecular drug D0K5LJ
N2-[4-(Benzyloxy)Benzyl]Glycinamide Small molecular drug D0T6XC
N2-{4-[(3-chlorobenzyl)Oxy]Benzyl}Glycinamide Small molecular drug D0T7EJ
N2-{4-[(3-fluorobenzyl)Oxy]Benzyl}Glycinamide Small molecular drug D02QBV
N2-{4-[(4-chlorobenzyl)Oxy]Benzyl}Glycinamide Small molecular drug D03XKJ
N2-{4-[(4-nitrobenzyl)Oxy]Benzyl}Glycinamide Small molecular drug D08BUB
Nsc-50187 Small molecular drug D0T7VA
Nsc-93405 Small molecular drug D0K8EE
Phenyl 4-(4,5-dihydro-1h-imidazol-2-yl)Benzoate Small molecular drug D08SRB
Pnu-22394 Small molecular drug D04QRS
Rauwolfia Serpentina Root Small molecular drug DB09363
Toloxatone Small molecular drug D0V3NT
Tracizoline Small molecular drug D09BIV
Trans-2-(4-chlorophenyl)-2-fluorocyclopropanamine Small molecular drug D03LGV
Trans-2-fluoro-2-(4-fluorophenyl)Cyclopropanamine Small molecular drug D08PHY
Trans-2-fluoro-2-p-tolylcyclopropanamine Small molecular drug D0F2DC
Trans-2-fluoro-2-phenylcyclopropylamin Small molecular drug D09HBX
Tryptoline Small molecular drug D03LPH
Var-10200 Small molecular drug D0V4KL
Var-10300 Small molecular drug D02AQM
[(1e)-4-phenylbut-1-enyl]Benzene Small molecular drug D0G2LF
(+/-)-7-methoxy-2-(4-methoxyphenyl)Chroman-4-one . D00HVZ
(+/-)-7-methoxy-2-phenylchroman-4-one . D0A2FO
(1z)-4-(4-fluorophenyl)-2-methylidenebutan-1-imine . DB08176
(R)-indan-1-yl-methyl-prop-2-ynyl-amine . D0S7FP
(S)-(+)-2-[4-(Fluorobenzyloxy-benzylamino)Propionamide] . DB08516
2-p-tolyl-4,5-dihydro-1h-imidazole . D01DEU
2-phenyl-cyclopropylamine Hydrochloride . D05LMT
4-fluoroselegiline . D07KIB
7-[(3-chlorobenzyl)Oxy]-4-[(Methylamino)Methyl]-2h-chromen-2-one . DB07513
Butyl-methyl-prop-2-ynyl-amine Hydrochloride . D07KCC
Heptyl-methyl-prop-2-ynyl-amine Hydrochloride . D0Z2NN
Isopropyl-methyl-prop-2-ynyl-amine Hydrochloride . D0X3SE
Jd-0100 . D09GQS
Methyl-pentyl-prop-2-ynyl-amine Oxalic Acid . D0N6JE
N-(2-aminoethyl)-p-chlorobenzamide . D0K0SA
N-(2-aminoethyl)-p-chlorobenzamide . DB08082
N-dodecyl-nn-dimethyl-3-ammonio-1-propanesulfonate . DB02643
N-methyl-n-[(1r)-1-methyl-2-phenylethyl]Prop-2-en-1-amine . DB04677
Nw-1772 . D0OW5Y
Rs-1636 . D0K4GD
Skl-pd . D00AHV
Vafidemstat . DB16446
Patented
Click To Hide/Show 73 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Cyclic Peptide Derivative 1 Peptide D04OEV
3-hydroxy-2-butanone Small molecular drug D00NDF
4-hydroxybenzaldehyde Small molecular drug D00BRD
Benzylcinnamate Small molecular drug D0XV2A
Coumarin/Resveratrol Hybrid Derivative 1 Small molecular drug D0L9FL
Coumarin/Resveratrol Hybrid Derivative 2 Small molecular drug D0Z5VD
Eugenol Small molecular drug D0O4QB
Ferulic Acid Small molecular drug D03SLR
Heteroaryl-cyclopropylamine Derivative 1 Small molecular drug D07NTA
Heteroaryl-cyclopropylamine Derivative 3 Small molecular drug D06VMN
Lazabemide Small molecular drug D06QRW
Lazabemide Analog 1 Small molecular drug D0C7LB
N-(2-phenylcyclopropyl) Amino Acid Derivative 1 Small molecular drug D0UL9U
N-(2-phenylcyclopropyl) Amino Acid Derivative 3 Small molecular drug D08IOP
Pmid25399762-compound-table1-c1 Small molecular drug D0Z6ZH
Pmid25399762-compound-table1-c10 Small molecular drug D00VSX
Pmid25399762-compound-table1-c11 Small molecular drug D0B2YJ
Pmid25399762-compound-table1-c12 Small molecular drug D05UNM
Pmid25399762-compound-table1-c13 Small molecular drug D01JDK
Pmid25399762-compound-table1-c14 Small molecular drug D0V2NC
Pmid25399762-compound-table1-c15 Small molecular drug D08YYW
Pmid25399762-compound-table1-c16 Small molecular drug D0AF7J
Pmid25399762-compound-table1-c17 Small molecular drug D00KTI
Pmid25399762-compound-table1-c18 Small molecular drug D02FRR
Pmid25399762-compound-table1-c19 Small molecular drug D01PCI
Pmid25399762-compound-table1-c2 Small molecular drug D0K2LB
Pmid25399762-compound-table1-c20 Small molecular drug D0UL2R
Pmid25399762-compound-table1-c21 Small molecular drug D0S2LV
Pmid25399762-compound-table1-c22 Small molecular drug D07GZU
Pmid25399762-compound-table1-c23 Small molecular drug D0HR6P
Pmid25399762-compound-table1-c24 Small molecular drug D04FJY
Pmid25399762-compound-table1-c25 Small molecular drug D0J3JY
Pmid25399762-compound-table1-c3 Small molecular drug D00YBT
Pmid25399762-compound-table1-c4 Small molecular drug D0Q1MN
Pmid25399762-compound-table1-c5 Small molecular drug D06BFA
Pmid25399762-compound-table1-c6 Small molecular drug D0DM9L
Pmid25399762-compound-table1-c7 Small molecular drug D0C2EW
Pmid25399762-compound-table1-c8 Small molecular drug D0GY4F
Pmid25399762-compound-table1-c9 Small molecular drug D06EIP
Pmid29324067-compound-38 Small molecular drug D04OXC
Pmid29324067-compound-40 Small molecular drug D07UZL
Pmid29757691-compound-4 Small molecular drug D0AA7U
Schiff Base Compound 1 Small molecular drug D05RJG
Schiff Base Compound 2 Small molecular drug D0DW5P
Secondary And Tertiary (Hetero)Arylamide Derivative 1 Small molecular drug D0J7HR
T83193"] Small molecular drug D0B5YS
Tacrine-coumarin Hybrid Derivative 1 Small molecular drug D0T9JB
Tarnylcypromine Derivative 2 Small molecular drug D04OHC
Tarnylcypromine Derivative 3 Small molecular drug D0O7IH
Tetra-hydro-isoquinoline Derivative 1 Small molecular drug D04AXC
Tetra-hydro-isoquinoline Derivative 2 Small molecular drug D0NB7Z
Tetra-hydro-isoquinoline Derivative 3 Small molecular drug D02EME
Tetra-hydro-isoquinoline Derivative 4 Small molecular drug D0R6RT
Tetra-hydro-oxazolopyridine Derivative 1 Small molecular drug D0GQ2Z
Tetra-hydro-oxazolopyridine Derivative 2 Small molecular drug D0DL1O
3,4-dihydroxybenzaldehyde . D03VOJ
4-hydroxy-2,5-dimethyl-3(2h)-furanone . D03ZOH
4-hydroxybenzoicacid . D0NH9P
4-hydroxybenzylalcohol . D0X7BT
4-methoxybenzaldehyde . D09SWE
Coumaricacid . D0BT3Y
Ethylvanillin . D0N9JJ
Piperonal . D0N3SU
Pmid25399762-compound-table 6-10 . D0AI6J
Pmid25399762-compound-table 6-11 . D02WXS
Pmid25399762-compound-table 6-12 . D0E7SF
Pmid25399762-compound-table 6-13 . D06KBT
Pmid25399762-compound-table 6-14 . D0PM2S
Pmid25399762-compound-table 6-15 . D0Q1EG
Pmid25399762-compound-table 6-9 . D0IO2A
Pmid25399762-compound-table 7-vanillic Acid . D0UA3V
Pmid25399762-compound-table 7-vanillyl Alcohol . D0ME4N
Pmid25399762-compound-table 7-veratraldehyde . D0TR7N
Discontinued
Click To Hide/Show 7 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
4-methoxyamphetamine Small molecular drug DB01472
As602868 Small molecular drug D01OLO
Milacemide Small molecular drug D07OLO
Mofegiline Small molecular drug D01LAC
Evt-301 . D0P1WB
Ht-1067 . D0O5QL
Sl-25.1188 . D0E3JL

References

1 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
2 Discovery of Potent and Selective Inhibitors against Protein-Derived Electrophilic Cofactors. J Am Chem Soc. 2022 Mar 30;144(12):5377-5388. doi: 10.1021/jacs.1c12748. Epub 2022 Mar 2.
3 Activity-Based Hydrazine Probes for Protein Profiling of Electrophilic Functionality in Therapeutic Targets. ACS Cent Sci. 2021 Sep 22;7(9):1524-1534. doi: 10.1021/acscentsci.1c00616. Epub 2021 Aug 19.
4 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.
5 Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.
6 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840