Details of the Target

General Information of Target

Target ID LDTP02031
Target Name Keratin, type II cytoskeletal 1 (KRT1)
Gene Name KRT1
Gene ID 3848
Synonyms
KRTA; Keratin, type II cytoskeletal 1; 67 kDa cytokeratin; Cytokeratin-1; CK-1; Hair alpha protein; Keratin-1; K1; Type-II keratin Kb1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSRQFSSRSGYRSGGGFSSGSAGIINYQRRTTSSSTRRSGGGGGRFSSCGGGGGSFGAGG
GFGSRSLVNLGGSKSISISVARGGGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFG
GFGSGGGGFGGGGFGGGGYGGGYGPVCPPGGIQEVTINQSLLQPLNVEIDPEIQKVKSRE
REQIKSLNNQFASFIDKVRFLEQQNQVLQTKWELLQQVDTSTRTHNLEPYFESFINNLRR
RVDQLKSDQSRLDSELKNMQDMVEDYRNKYEDEINKRTNAENEFVTIKKDVDGAYMTKVD
LQAKLDNLQQEIDFLTALYQAELSQMQTQISETNVILSMDNNRSLDLDSIIAEVKAQYED
IAQKSKAEAESLYQSKYEELQITAGRHGDSVRNSKIEISELNRVIQRLRSEIDNVKKQIS
NLQQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIA
TYRTLLEGEESRMSGECAPNVSVSVSTSHTTISGGGSRGGGGGGYGSGGSSYGSGGGSYG
SGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSG
GRGSGGGSSGGSIGGRGSSSGGVKSSGGSSSVKFVSTTYSGVTR
Target Bioclass
Other
Family
Intermediate filament family
Subcellular location
Cell membrane
Function
May regulate the activity of kinases such as PKC and SRC via binding to integrin beta-1 (ITB1) and the receptor of activated protein C kinase 1 (RACK1). In complex with C1QBP is a high affinity receptor for kininogen-1/HMWK.
Uniprot ID
P04264
Ensemble ID
ENST00000252244.3
HGNC ID
HGNC:6412

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 12 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
P2
 Probe Info  		1.92  LDD0453  [1]
YN-4
 Probe Info  		100.00  LDD0445  [2]
AF-1
 Probe Info  		1.88  LDD0421  [3]
AF-2
 Probe Info  		2.37  LDD0422  [3]
DBIA
 Probe Info  		C49(26.03)  LDD3319  [4]
AZ-9
 Probe Info  		10.00  LDD2154  [5]
Jackson_14
 Probe Info  		16.67  LDD0123  [6]
Johansson_61
 Probe Info  		_(10.07)  LDD1485  [7]
IMP-1710
 Probe Info  		2.58  LDD0040  [8]
IA-alkyne
 Probe Info  		N.A.  LDD0036  [9]
Lodoacetamide azide
 Probe Info  		C49(0.00); C497(0.00)  LDD0037  [9]
YN-1
 Probe Info  		N.A.  LDD0447  [2]
PAL-AfBPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STS-2
 Probe Info  		2.06  LDD0139  [10]
VE-P
 Probe Info  		N.A.  LDD0396  [11]
STS-1
 Probe Info  		N.A.  LDD0069  [12]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0166  Afatinib A431 1.88  LDD0421  [3]
 LDCM0151  AZ-11 HeLa 10.00  LDD2154  [5]
 LDCM0617  Fragment63-S Jurkat _(20.00)  LDD1491  [7]
 LDCM0569  Fragment7 Jurkat _(10.07)  LDD1485  [7]
 LDCM0022  KB02 A101D C49(6.69)  LDD2250  [4]
 LDCM0023  KB03 A101D C49(9.20)  LDD2667  [4]
 LDCM0024  KB05 MEWO C49(26.03)  LDD3319  [4]
 LDCM0001  Panyain_cp1 HEK-293T 2.58  LDD0040  [8]
 LDCM0016  Ranjitkar_cp1 MDA-MB-231 16.67  LDD0123  [6]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
TLC domain-containing protein 4 (TLCD4) TLCD4 family Q96MV1
Zinc finger protein RFP (TRIM27) TRIM/RBCC family P14373
Tripartite motif-containing protein 54 (TRIM54) . Q9BYV2
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Nuclear pore glycoprotein p62 (NUP62) Nucleoporin NSP1/NUP62 family P37198
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
High mobility group protein 20A (HMG20A) . Q9NP66
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Free fatty acid receptor 2 (FFAR2) G-protein coupled receptor 1 family O15552
Other
Click To Hide/Show 26 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Angiomotin-like protein 2 (AMOTL2) Angiomotin family Q9Y2J4
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
HAUS augmin-like complex subunit 1 (HAUS1) HAUS1 family Q96CS2
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cuticular Ha3-II (KRT33B) Intermediate filament family Q14525
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Keratin, type I cuticular Ha5 (KRT35) Intermediate filament family Q92764
Keratin, type I cuticular Ha7 (KRT37) Intermediate filament family O76014
Keratin, type I cuticular Ha8 (KRT38) Intermediate filament family O76015
Keratin, type I cytoskeletal 10 (KRT10) Intermediate filament family P13645
Keratin, type I cytoskeletal 13 (KRT13) Intermediate filament family P13646
Keratin, type I cytoskeletal 14 (KRT14) Intermediate filament family P02533
Keratin, type I cytoskeletal 15 (KRT15) Intermediate filament family P19012
Keratin, type I cytoskeletal 16 (KRT16) Intermediate filament family P08779
Keratin, type I cytoskeletal 19 (KRT19) Intermediate filament family P08727
Keratin, type I cytoskeletal 24 (KRT24) Intermediate filament family Q2M2I5
Keratin, type I cytoskeletal 25 (KRT25) Intermediate filament family Q7Z3Z0
Keratin, type I cytoskeletal 26 (KRT26) Intermediate filament family Q7Z3Y9
Keratin, type I cytoskeletal 27 (KRT27) Intermediate filament family Q7Z3Y8
Keratin, type I cytoskeletal 28 (KRT28) Intermediate filament family Q7Z3Y7
Keratin, type I cytoskeletal 39 (KRT39) Intermediate filament family Q6A163
RAD50-interacting protein 1 (RINT1) RINT1 family Q6NUQ1
Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB) SGT family Q96EQ0
Splicing factor U2AF 35 kDa subunit (U2AF1) Splicing factor SR family Q01081
Tuftelin-interacting protein 11 (TFIP11) TFP11/STIP family Q9UBB9

The Drug(s) Related To This Target

Approved
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Copper . DB09130
Zinc . DB01593
Zinc Acetate . DB14487

References

1 Comparison of Different Competitive Proteome Profiling Approaches in Target Identification of Covalent Inhibitors. Chembiochem. 2022 Dec 16;23(24):e202200389. doi: 10.1002/cbic.202200389. Epub 2022 Nov 22.
2 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
3 Minimalist linkers suitable for irreversible inhibitors in simultaneous proteome profiling, live-cell imaging and drug screening. Chem Commun (Camb). 2019 Jan 15;55(6):834-837. doi: 10.1039/c8cc08685k.
4 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
5 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
6 Appendage and Scaffold Diverse Fully Functionalized Small-Molecule Probes via a Minimalist Terminal Alkyne-Aliphatic Diazirine Isocyanide. J Org Chem. 2018 Sep 21;83(18):11245-11253. doi: 10.1021/acs.joc.8b01831. Epub 2018 Aug 31.
7 Proteome-wide covalent ligand discovery in native biological systems. Nature. 2016 Jun 23;534(7608):570-4. doi: 10.1038/nature18002. Epub 2016 Jun 15.
8 Correction to "Discovery of a Potent and Selective Covalent Inhibitor and Activity-Based Probe for the Deubiquitylating Enzyme UCHL1, with Antifibrotic Activity". J Am Chem Soc. 2020 Sep 2;142(35):15199. doi: 10.1021/jacs.0c08385. Epub 2020 Aug 19.
Mass spectrometry data entry: PXD015825
9 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
10 Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.
11 Pharmacological Targeting of Vacuolar H(+)-ATPase via Subunit V1G Combats Multidrug-Resistant Cancer. Cell Chem Biol. 2020 Nov 19;27(11):1359-1370.e8. doi: 10.1016/j.chembiol.2020.06.011. Epub 2020 Jul 9.
12 Proteome profiling reveals potential cellular targets of staurosporine using a clickable cell-permeable probe. Chem Commun (Camb). 2011 Oct 28;47(40):11306-8. doi: 10.1039/c1cc14824a. Epub 2011 Sep 16.