Details of the Target

General Information of Target

Target ID LDTP07508
Target Name Polyamine-modulated factor 1 (PMF1)
Gene Name PMF1
Gene ID 100527963
Synonyms
Polyamine-modulated factor 1; PMF-1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAEASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGSYQRFTD
CYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNALDKIVEEGKVRKE
PAWRPSGIPEKDLHSVMAPYFLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQV
QAQQQAWQALHREQRELVAVLREPE
Target Bioclass
Other
Subcellular location
Nucleus
Function
Part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis. May act as a cotranscription partner of NFE2L2 involved in regulation of polyamine-induced transcription of SSAT.
Uniprot ID
Q6P1K2
Ensemble ID
ENST00000368273.8
HGNC ID
HGNC:9112

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
NB4 SNV: p.Q179Ter .
OVK18 SNV: p.A199V .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 16 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
C-Sul
 Probe Info  		5.77  LDD0066  [2]
STPyne
 Probe Info  		K154(1.18)  LDD0277  [3]
Probe 1
 Probe Info  		Y55(7.89)  LDD3495  [4]
Curcusone 37
 Probe Info  		3.02  LDD0188  [5]
YY4-yne
 Probe Info  		3.39  LDD0400  [6]
IA-alkyne
 Probe Info  		C64(2.29)  LDD0372  [7]
DBIA
 Probe Info  		C61(4.70)  LDD0209  [8]
IPM
 Probe Info  		N.A.  LDD0025  [9]
JW-RF-010
 Probe Info  		N.A.  LDD0026  [9]
TFBX
 Probe Info  		N.A.  LDD0027  [9]
ENE
 Probe Info  		N.A.  LDD0006  [10]
PF-06672131
 Probe Info  		N.A.  LDD0017  [11]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [12]
AOyne
 Probe Info  		14.40  LDD0443  [13]
NAIA_5
 Probe Info  		N.A.  LDD2223  [14]
PAL-AfBPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C055
 Probe Info  		11.63  LDD1752  [15]
C100
 Probe Info  		4.99  LDD1789  [15]
C178
 Probe Info  		22.78  LDD1857  [15]
C429
 Probe Info  		12.64  LDD2084  [15]
C431
 Probe Info  		24.25  LDD2086  [15]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0026  4SU-RNA+native RNA HEK-293T C64(2.29)  LDD0372  [7]
 LDCM0156  Aniline NCI-H1299 15.00  LDD0403  [1]
 LDCM0632  CL-Sc Hep-G2 C13(1.30); C13(0.89)  LDD2227  [14]
 LDCM0033  Curcusone1d MCF-7 3.02  LDD0188  [5]
 LDCM0022  KB02 T cell-activated C64(12.95)  LDD1708  [16]
 LDCM0023  KB03 Jurkat C61(4.70)  LDD0209  [8]
 LDCM0024  KB05 NCI-N87 C64(2.58)  LDD3364  [17]
 LDCM0154  YY4 T cell 3.39  LDD0400  [6]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cation channel sperm-associated protein 1 (CATSPER1) Cation channel sperm-associated (TC 1.A.1.19) family Q8NEC5
Huntingtin (HTT) Huntingtin family P42858
Nucleoporin p58/p45 (NUP58) NUP58 family Q9BVL2
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Nuclear factor erythroid 2-related factor 2 (NFE2L2) BZIP family Q16236
Krueppel-like factor 11 (KLF11) Sp1 C2H2-type zinc-finger protein family O14901
Other
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
DNA damage-inducible transcript 4 protein (DDIT4) DDIT4 family Q9NX09
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
LRP chaperone MESD (MESD) MESD family Q14696
Protein MIS12 homolog (MIS12) Mis12 family Q9H081
Translin-associated protein X (TSNAX) Translin family Q99598
EF-hand domain-containing protein 1 (EFHC1) . Q5JVL4
F-box only protein 28 (FBXO28) . Q9NVF7
SHC-transforming protein 3 (SHC3) . Q92529
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) . Q7Z699
TBC1 domain family member 21 (TBC1D21) . Q8IYX1

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Low-Toxicity Sulfonium-Based Probes for Cysteine-Specific Profiling in Live Cells. Anal Chem. 2022 Mar 15;94(10):4366-4372. doi: 10.1021/acs.analchem.1c05129. Epub 2022 Mar 4.
3 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
4 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
5 Total Synthesis and Target Identification of the Curcusone Diterpenes. J Am Chem Soc. 2021 Mar 24;143(11):4379-4386. doi: 10.1021/jacs.1c00557. Epub 2021 Mar 11.
6 A Chemical Proteomic Probe for the Mitochondrial Pyruvate Carrier Complex. Angew Chem Int Ed Engl. 2020 Mar 2;59(10):3896-3899. doi: 10.1002/anie.201914391. Epub 2020 Feb 11.
7 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
8 Covalent Inhibition by a Natural Product-Inspired Latent Electrophile. J Am Chem Soc. 2023 May 24;145(20):11097-11109. doi: 10.1021/jacs.3c00598. Epub 2023 May 15.
9 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
10 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
11 Site-Specific Activity-Based Protein Profiling Using Phosphonate Handles. Mol Cell Proteomics. 2023 Jan;22(1):100455. doi: 10.1016/j.mcpro.2022.100455. Epub 2022 Nov 24.
Mass spectrometry data entry: PXD036569
12 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
13 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
14 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
15 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
16 An Activity-Guided Map of Electrophile-Cysteine Interactions in Primary Human T Cells. Cell. 2020 Aug 20;182(4):1009-1026.e29. doi: 10.1016/j.cell.2020.07.001. Epub 2020 Jul 29.
17 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840