Details of the Target

General Information of Target

Target ID LDTP04663
Target Name Bax inhibitor 1 (TMBIM6)
Gene Name TMBIM6
Gene ID 7009
Synonyms
BI1; TEGT; Bax inhibitor 1; BI-1; Testis-enhanced gene transcript protein; Transmembrane BAX inhibitor motif-containing protein 6
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLS
ALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMG
TAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVV
MCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMILAMNEKDKKKEKK
Target Type
Literature-reported
Target Bioclass
Transporter and channel
Family
BI1 family
Subcellular location
Endoplasmic reticulum membrane
Function
Suppressor of apoptosis. Modulates unfolded protein response signaling. Modulates ER calcium homeostasis by acting as a calcium-leak channel. Negatively regulates autophagy and autophagosome formation, especially during periods of nutrient deprivation, and reduces cell survival during starvation.
TTD ID
T29594
Uniprot ID
P55061
DrugMap ID
TT7QSMG
Ensemble ID
ENST00000267115.10
HGNC ID
HGNC:11723

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HCC44 SNV: p.L159P .
HT SNV: p.N9S .
IPC298 SNV: p.L114F .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info  		K7(7.87)  LDD0277  [1]
FBP2
 Probe Info  		2.90  LDD0320  [2]
PAL-AfBPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C091
 Probe Info  		11.55  LDD1782  [3]
C092
 Probe Info  		23.43  LDD1783  [3]
C094
 Probe Info  		42.22  LDD1785  [3]
C287
 Probe Info  		9.65  LDD1957  [3]
C362
 Probe Info  		41.93  LDD2023  [3]
FFF probe11
 Probe Info  		20.00  LDD0471  [4]
FFF probe13
 Probe Info  		20.00  LDD0475  [4]
OEA-DA
 Probe Info  		19.11  LDD0046  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0137  SR-4995 HEK-293T 3.17  LDD0342  [5]
 LDCM0008  Tranylcypromine HeLa 2.90  LDD0320  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (EBP) EBP family Q15125
Probable glutathione peroxidase 8 (GPX8) Glutathione peroxidase family Q8TED1
Sterol O-acyltransferase 2 (SOAT2) Membrane-bound acyltransferase family O75908
Bis(5'-adenosyl)-triphosphatase ENPP4 (ENPP4) Nucleotide pyrophosphatase/phosphodiesterase family Q9Y6X5
Presenilin-1 (PSEN1) Peptidase A22A family P49768
Granzyme K (GZMK) Peptidase S1 family P49863
Cell division cycle 7-related protein kinase (CDC7) Ser/Thr protein kinase family O00311
STEAP family member 1B (STEAP1B) STEAP family Q6NZ63
UDP-glucuronosyltransferase 2B11 (UGT2B11) UDP-glycosyltransferase family O75310
E3 ubiquitin-protein ligase RNF185 (RNF185) . Q96GF1
Transporter and channel
Click To Hide/Show 17 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Adiponectin receptor protein 2 (ADIPOR2) ADIPOR family Q86V24
High affinity cationic amino acid transporter 1 (SLC7A1) Cationic amino acid transporter (CAT) (TC 2.A.3.3) family P30825
Claudin-22 (CLDN22) Claudin family Q8N7P3
Gap junction alpha-5 protein (GJA5) Connexin family P36382
Gap junction alpha-8 protein (GJA8) Connexin family P48165
Gap junction beta-4 protein (GJB4) Connexin family Q9NTQ9
Glycophorin-A (GYPA) Glycophorin A family P02724
Hippocampus abundant transcript-like protein 1 (MFSD14B) Major facilitator superfamily Q5SR56
ER membrane protein complex subunit 5 (MMGT1) Membrane magnesium transporter (TC 1.A.67) family Q8N4V1
Membrane-spanning 4-domains subfamily A member 3 (MS4A3) MS4A family Q96HJ5
Potassium voltage-gated channel subfamily A member 10 (KCNA10) Potassium channel family Q16322
Potassium voltage-gated channel subfamily C member 1 (KCNC1) Potassium channel family P48547
Solute carrier family 41 member 3 (SLC41A3) SLC41A transporter family Q96GZ6
Sodium channel regulatory subunit beta-3 (SCN3B) Sodium channel auxiliary subunit SCN3B family Q9NY72
Leucine-rich repeat-containing protein 59 (LRRC59) . Q96AG4
Thioredoxin-related transmembrane protein 2 (TMX2) . Q9Y320
Transmembrane and ubiquitin-like domain-containing protein 1 (TMUB1) . Q9BVT8
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-responsive element-binding protein 3-like protein 1 (CREB3L1) BZIP family Q96BA8
GPCR
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
5-hydroxytryptamine receptor 2C (HTR2C) G-protein coupled receptor 1 family P28335
G-protein coupled receptor 151 (GPR151) G-protein coupled receptor 1 family Q8TDV0
G-protein coupled receptor 42 (GPR42) G-protein coupled receptor 1 family O15529
Immunoglobulin
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
CMRF35-like molecule 9 (CD300LG) CD300 family Q6UXG3
Poliovirus receptor (PVR) Nectin family P15151
B-cell antigen receptor complex-associated protein alpha chain (CD79A) . P11912
Endothelial cell-selective adhesion molecule (ESAM) . Q96AP7
SLAM family member 6 (SLAMF6) . Q96DU3
Trem-like transcript 1 protein (TREML1) . Q86YW5
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Tumor necrosis factor receptor superfamily member 17 (TNFRSF17) . Q02223
Other
Click To Hide/Show 17 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
CD99 antigen-like protein 2 (CD99L2) CD99 family Q8TCZ2
Peptidase inhibitor 16 (PI16) CRISP family Q6UXB8
Receptor expression-enhancing protein 2 (REEP2) DP1 family Q9BRK0
Protein FAM209A (FAM209A) FAM209 family Q5JX71
Fibroblast growth factor-binding protein 2 (FGFBP2) Fibroblast growth factor-binding protein family Q9BYJ0
Glycoprotein hormone beta-5 (GPHB5) Glycoprotein hormones subunit beta family Q86YW7
Radiation-inducible immediate-early gene IEX-1 (IER3) IER3 family P46695
Synaptotagmin-9 (SYT9) Synaptotagmin family Q86SS6
Protein MANBAL (MANBAL) UPF0239 family Q9NQG1
Endoplasmic reticulum resident protein 29 (ERP29) . P30040
Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein (HERPUD2) . Q9BSE4
Junctional sarcoplasmic reticulum protein 1 (JSRP1) . Q96MG2
Lck-interacting transmembrane adapter 1 (LIME1) . Q9H400
Outer dense fiber protein 4 (ODF4) . Q2M2E3
PILR alpha-associated neural protein (PIANP) . Q8IYJ0
Signaling threshold-regulating transmembrane adapter 1 (SIT1) . Q9Y3P8
Testis-expressed protein 29 (TEX29) . Q8N6K0

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 Tranylcypromine specificity for monoamine oxidase is limited by promiscuous protein labelling and lysosomal trapping. RSC Chem Biol. 2020 Aug 12;1(4):209-213. doi: 10.1039/d0cb00048e. eCollection 2020 Oct 1.
Mass spectrometry data entry: PXD018580
3 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
4 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.
5 Mapping Protein Targets of Bioactive Small Molecules Using Lipid-Based Chemical Proteomics. ACS Chem Biol. 2017 Oct 20;12(10):2671-2681. doi: 10.1021/acschembio.7b00581. Epub 2017 Sep 20.
Mass spectrometry data entry: PXD007570