Details of the Target

General Information of Target

Target ID LDTP00014
Target Name Extended synaptotagmin-2 (ESYT2)
Gene Name ESYT2
Gene ID 57488
Synonyms
FAM62B; KIAA1228; Extended synaptotagmin-2; E-Syt2; Chr2Syt
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MTANRDAALSSHRHPGCAQRPRTPTFASSSQRRSAFGFDDGNFPGLGERSHAPGSRLGAR
RRAKTARGLRGHRQRGAGAGLSRPGSARAPSPPRPGGPENPGGVLSVELPGLLAQLARSF
ALLLPVYALGYLGLSFSWVLLALALLAWCRRSRGLKALRLCRALALLEDEERVVRLGVRA
CDLPAWVHFPDTERAEWLNKTVKHMWPFICQFIEKLFRETIEPAVRGANTHLSTFSFTKV
DVGQQPLRINGVKVYTENVDKRQIILDLQISFVGNCEIDLEIKRYFCRAGVKSIQIHGTM
RVILEPLIGDMPLVGALSIFFLRKPLLEINWTGLTNLLDVPGLNGLSDTIILDIISNYLV
LPNRITVPLVSEVQIAQLRFPVPKGVLRIHFIEAQDLQGKDTYLKGLVKGKSDPYGIIRV
GNQIFQSRVIKENLSPKWNEVYEALVYEHPGQELEIELFDEDPDKDDFLGSLMIDLIEVE
KERLLDEWFTLDEVPKGKLHLRLEWLTLMPNASNLDKVLTDIKADKDQANDGLSSALLIL
YLDSARNLPSGKKISSNPNPVVQMSVGHKAQESKIRYKTNEPVWEENFTFFIHNPKRQDL
EVEVRDEQHQCSLGNLKVPLSQLLTSEDMTVSQRFQLSNSGPNSTIKMKIALRVLHLEKR
ERPPDHQHSAQVKRPSVSKEGRKTSIKSHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEKA
QPPEAGPQGLHDLGRSSSSLLASPGHISVKEPTPSIASDISLPIATQELRQRLRQLENGT
TLGQSPLGQIQLTIRHSSQRNKLIVVVHACRNLIAFSEDGSDPYVRMYLLPDKRRSGRRK
THVSKKTLNPVFDQSFDFSVSLPEVQRRTLDVAVKNSGGFLSKDKGLLGKVLVALASEEL
AKGWTQWYDLTEDGTRPQAMT
Target Bioclass
Transporter and channel
Family
Extended synaptotagmin family
Subcellular location
Cell membrane
Function
Tethers the endoplasmic reticulum to the cell membrane and promotes the formation of appositions between the endoplasmic reticulum and the cell membrane. Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport. Plays a role in FGF signaling via its role in the rapid internalization of FGFR1 that has been activated by FGF1 binding; this occurs most likely via the AP-2 complex. Promotes the localization of SACM1L at endoplasmic reticulum-plasma membrane contact sites (EPCS).
Uniprot ID
A0FGR8
Ensemble ID
ENST00000652148.1
HGNC ID
HGNC:22211

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 29 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		11.20  LDD0402  [1]
HDSF-alk
 Probe Info  		2.84  LDD0197  [2]
CHEMBL5175495
 Probe Info  		5.76  LDD0196  [3]
TG42
 Probe Info  		4.33  LDD0326  [4]
W1
 Probe Info  		16.82  LDD0235  [5]
STPyne
 Probe Info  		K261(6.48); K384(10.00); K405(5.88); K411(4.79)  LDD0277  [6]
DBIA
 Probe Info  		C831(2.42)  LDD3310  [7]
DA-P3
 Probe Info  		4.59  LDD0182  [8]
AHL-Pu-1
 Probe Info  		C181(3.71)  LDD0168  [9]
5E-2FA
 Probe Info  		H609(0.00); H689(0.00)  LDD2235  [10]
AMP probe
 Probe Info  		K875(0.00); K883(0.00)  LDD0200  [11]
ATP probe
 Probe Info  		K875(0.00); K883(0.00)  LDD0199  [11]
4-Iodoacetamidophenylacetylene
 Probe Info  		C210(0.00); C181(0.00); C810(0.00); C611(0.00)  LDD0038  [12]
IA-alkyne
 Probe Info  		C181(0.00); C210(0.00); C810(0.00)  LDD0036  [12]
IPIAA_H
 Probe Info  		N.A.  LDD0030  [13]
IPIAA_L
 Probe Info  		C181(0.00); C611(0.00)  LDD0031  [13]
Lodoacetamide azide
 Probe Info  		C181(0.00); C611(0.00); C210(0.00); C810(0.00)  LDD0037  [12]
NAIA_4
 Probe Info  		C181(0.00); C611(0.00)  LDD2226  [14]
Compound 10
 Probe Info  		N.A.  LDD2216  [15]
Compound 11
 Probe Info  		N.A.  LDD2213  [15]
IPM
 Probe Info  		N.A.  LDD0005  [16]
TFBX
 Probe Info  		C611(0.00); C181(0.00)  LDD0148  [17]
VSF
 Probe Info  		N.A.  LDD0007  [16]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [18]
Acrolein
 Probe Info  		C611(0.00); C181(0.00)  LDD0217  [19]
Crotonaldehyde
 Probe Info  		C611(0.00); H666(0.00)  LDD0219  [19]
Methacrolein
 Probe Info  		N.A.  LDD0218  [19]
AOyne
 Probe Info  		6.90  LDD0443  [20]
NAIA_5
 Probe Info  		N.A.  LDD2223  [14]
PAL-AfBPP Probe
Click To Hide/Show 9 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C289
 Probe Info  		25.28  LDD1959  [21]
FFF probe11
 Probe Info  		20.00  LDD0471  [22]
FFF probe13
 Probe Info  		20.00  LDD0475  [22]
FFF probe14
 Probe Info  		20.00  LDD0477  [22]
FFF probe3
 Probe Info  		20.00  LDD0464  [22]
STS-1
 Probe Info  		1.00  LDD0137  [23]
STS-2
 Probe Info  		N.A.  LDD0138  [23]
Staurosporine capture compound
 Probe Info  		N.A.  LDD0083  [24]
OEA-DA
 Probe Info  		5.08  LDD0046  [25]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0025  4SU-RNA HEK-293T C181(3.71)  LDD0168  [9]
 LDCM0026  4SU-RNA+native RNA HEK-293T C181(3.75)  LDD0169  [9]
 LDCM0108  Chloroacetamide HeLa C611(0.00); C181(0.00)  LDD0222  [19]
 LDCM0632  CL-Sc Hep-G2 C181(0.79)  LDD2227  [14]
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C181(15.38); C611(1.68)  LDD1702  [26]
 LDCM0625  F8 Ramos C181(0.84)  LDD2187  [27]
 LDCM0573  Fragment11 Ramos C181(0.54)  LDD2190  [27]
 LDCM0575  Fragment13 Ramos C181(0.82)  LDD2192  [27]
 LDCM0576  Fragment14 Ramos C181(1.17)  LDD2193  [27]
 LDCM0580  Fragment21 Ramos C181(0.99)  LDD2195  [27]
 LDCM0582  Fragment23 Ramos C181(0.58)  LDD2196  [27]
 LDCM0578  Fragment27 Ramos C181(0.91)  LDD2197  [27]
 LDCM0586  Fragment28 Ramos C181(1.66)  LDD2198  [27]
 LDCM0588  Fragment30 Ramos C181(0.93)  LDD2199  [27]
 LDCM0589  Fragment31 Ramos C181(1.09)  LDD2200  [27]
 LDCM0468  Fragment33 Ramos C181(1.81)  LDD2202  [27]
 LDCM0596  Fragment38 Ramos C181(1.02)  LDD2203  [27]
 LDCM0566  Fragment4 Ramos C181(1.81)  LDD2184  [27]
 LDCM0614  Fragment56 Ramos C181(0.78)  LDD2205  [27]
 LDCM0569  Fragment7 Ramos C181(1.27)  LDD2186  [27]
 LDCM0107  IAA HeLa H746(0.00); H188(0.00)  LDD0221  [19]
 LDCM0022  KB02 HEK-293T C611(0.96); C181(0.92); C210(1.05)  LDD1492  [28]
 LDCM0023  KB03 HEK-293T C611(0.97); C181(0.99); C210(0.91)  LDD1497  [28]
 LDCM0024  KB05 COLO792 C831(2.42)  LDD3310  [7]
 LDCM0030  Luteolin HEK-293T 4.59  LDD0182  [8]
 LDCM0109  NEM HeLa H746(0.00); C810(0.00); H731(0.00)  LDD0223  [19]
 LDCM0628  OTUB2-COV-1 HEK-293T C181(1.27)  LDD2207  [29]
 LDCM0131  RA190 MM1.R C181(1.62)  LDD0304  [30]
 LDCM0019  Staurosporine Hep-G2 N.A.  LDD0083  [24]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Extended synaptotagmin-1 (ESYT1) Extended synaptotagmin family Q9BSJ8
Extended synaptotagmin-2 (ESYT2) Extended synaptotagmin family A0FGR8
Extended synaptotagmin-3 (ESYT3) Extended synaptotagmin family A0FGR9

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Fatty Acyl Sulfonyl Fluoride as an Activity-Based Probe for Profiling Fatty Acid-Associated Proteins in Living Cells. Chembiochem. 2022 Feb 16;23(4):e202100628. doi: 10.1002/cbic.202100628. Epub 2021 Dec 30.
3 Charting the Chemical Space of Acrylamide-Based Inhibitors of zDHHC20. ACS Med Chem Lett. 2022 Sep 26;13(10):1648-1654. doi: 10.1021/acsmedchemlett.2c00336. eCollection 2022 Oct 13.
4 Design and synthesis of tailored human caseinolytic protease P inhibitors. Chem Commun (Camb). 2018 Aug 28;54(70):9833-9836. doi: 10.1039/c8cc05265d.
Mass spectrometry data entry: PXD010277
5 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
6 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
7 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
8 A chemical probe unravels the reactive proteome of health-associated catechols. Chem Sci. 2023 Jul 22;14(32):8635-8643. doi: 10.1039/d3sc00888f. eCollection 2023 Aug 16.
Mass spectrometry data entry: PXD043348
9 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
10 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
11 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
12 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
13 SP3-Enabled Rapid and High Coverage Chemoproteomic Identification of Cell-State-Dependent Redox-Sensitive Cysteines. Mol Cell Proteomics. 2022 Apr;21(4):100218. doi: 10.1016/j.mcpro.2022.100218. Epub 2022 Feb 25.
Mass spectrometry data entry: PXD029500 , PXD031647
14 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
15 Multiplexed CuAAC Suzuki-Miyaura Labeling for Tandem Activity-Based Chemoproteomic Profiling. Anal Chem. 2021 Feb 2;93(4):2610-2618. doi: 10.1021/acs.analchem.0c04726. Epub 2021 Jan 20.
Mass spectrometry data entry: PXD022279
16 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
17 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
18 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
19 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
20 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
21 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
22 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.
23 Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.
24 Comprehensive identification of staurosporine-binding kinases in the hepatocyte cell line HepG2 using Capture Compound Mass Spectrometry (CCMS). J Proteome Res. 2010 Feb 5;9(2):806-17. doi: 10.1021/pr9007333.
25 Mapping Protein Targets of Bioactive Small Molecules Using Lipid-Based Chemical Proteomics. ACS Chem Biol. 2017 Oct 20;12(10):2671-2681. doi: 10.1021/acschembio.7b00581. Epub 2017 Sep 20.
Mass spectrometry data entry: PXD007570
26 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
27 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
28 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
29 Rapid Covalent-Probe Discovery by Electrophile-Fragment Screening. J Am Chem Soc. 2019 Jun 5;141(22):8951-8968. doi: 10.1021/jacs.9b02822. Epub 2019 May 22.
30 Physical and Functional Analysis of the Putative Rpn13 Inhibitor RA190. Cell Chem Biol. 2020 Nov 19;27(11):1371-1382.e6. doi: 10.1016/j.chembiol.2020.08.007. Epub 2020 Aug 27.