Details of the Target
General Information of Target
| Target ID | LDTP15741 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cytochrome c oxidase assembly protein COX14 (COX14) | |||||
| Gene Name | COX14 | |||||
| Gene ID | 84987 | |||||
| Synonyms |
C12orf62; Cytochrome c oxidase assembly protein COX14 |
|||||
| 3D Structure | ||||||
| Sequence |
MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQIT
DTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVG NKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDG KKSKQQKRKEKLKGKCVIM |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Mitochondrion membrane
|
|||||
| Function |
Core component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly. Requires for coordination of the early steps of cytochrome c oxidase assembly with the synthesis of MT-CO1.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TFBX Probe Info |
![]() |
N.A. | LDD0027 | [1] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C055 Probe Info |
![]() |
14.83 | LDD1752 | [2] | |
|
C056 Probe Info |
![]() |
25.11 | LDD1753 | [2] | |
|
C106 Probe Info |
![]() |
16.45 | LDD1793 | [2] | |
|
C112 Probe Info |
![]() |
24.08 | LDD1799 | [2] | |
|
C252 Probe Info |
![]() |
11.31 | LDD1925 | [2] | |
|
C278 Probe Info |
![]() |
77.71 | LDD1948 | [2] | |
|
C293 Probe Info |
![]() |
24.25 | LDD1963 | [2] | |
|
C388 Probe Info |
![]() |
83.29 | LDD2047 | [2] | |
The Interaction Atlas With This Target
References









