Details of the Target
General Information of Target
| Target ID | LDTP14125 | |||||
|---|---|---|---|---|---|---|
| Target Name | Mitochondrial import inner membrane translocase subunit Tim10 B (TIMM10B) | |||||
| Gene Name | TIMM10B | |||||
| Gene ID | 26515 | |||||
| Synonyms |
FXC1; TIM9B; TIMM9B; Mitochondrial import inner membrane translocase subunit Tim10 B; Fracture callus protein 1; FxC1; Mitochondrial import inner membrane translocase subunit Tim9 B; TIMM10B; Tim10b |
|||||
| 3D Structure | ||||||
| Sequence |
MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKA
VECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSL GTGTLVS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Small Tim family
|
|||||
| Subcellular location |
Mitochondrion inner membrane
|
|||||
| Function |
Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70 kDa complex that guides the target proteins in transit through the aqueous mitochondrial intermembrane space.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [1] | |
|
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [1] | |
|
CY4 Probe Info |
![]() |
R12(0.00); R15(0.00) | LDD0247 | [2] | |
|
NAIA_5 Probe Info |
![]() |
C32(0.00); C28(0.00) | LDD2223 | [3] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C106 Probe Info |
![]() |
21.41 | LDD1793 | [4] | |
|
C108 Probe Info |
![]() |
8.06 | LDD1795 | [4] | |
|
C161 Probe Info |
![]() |
10.63 | LDD1841 | [4] | |
|
C201 Probe Info |
![]() |
36.50 | LDD1877 | [4] | |
|
C206 Probe Info |
![]() |
16.45 | LDD1881 | [4] | |
|
C218 Probe Info |
![]() |
11.47 | LDD1892 | [4] | |
|
C220 Probe Info |
![]() |
17.51 | LDD1894 | [4] | |
|
C289 Probe Info |
![]() |
32.00 | LDD1959 | [4] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Eukaryotic translation initiation factor 3 subunit F (EIF3F) | EIF-3 subunit F family | O00303 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) | . | O14964 | |||
| Kelch-like protein 38 (KLHL38) | . | Q2WGJ6 | |||
References












