Details of the Target
General Information of Target
| Target ID | LDTP11001 | |||||
|---|---|---|---|---|---|---|
| Target Name | Histone H2B type 1-L (H2BC13) | |||||
| Gene Name | H2BC13 | |||||
| Gene ID | 8340 | |||||
| Synonyms |
H2BFC; HIST1H2BL; Histone H2B type 1-L; Histone H2B.c; H2B/c |
|||||
| 3D Structure | ||||||
| Sequence |
MPEPVKSAPVPKKGSKKAINKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Histone H2B family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TH211 Probe Info |
![]() |
Y122(20.00); Y84(16.42); Y41(6.07) | LDD0257 | [1] | |
|
TH216 Probe Info |
![]() |
Y84(20.00); Y122(16.93) | LDD0259 | [1] | |
|
STPyne Probe Info |
![]() |
K6(7.19) | LDD0277 | [2] | |
|
ONAyne Probe Info |
![]() |
N.A. | LDD0273 | [2] | |
|
HHS-482 Probe Info |
![]() |
Y84(1.47) | LDD0285 | [3] | |
|
HHS-475 Probe Info |
![]() |
Y84(1.13) | LDD0264 | [4] | |
|
HHS-465 Probe Info |
![]() |
Y84(2.95) | LDD2237 | [5] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0223 | [6] | |
|
CY-1 Probe Info |
![]() |
E114(0.00); E106(0.00); H110(0.00); K117(0.00) | LDD0246 | [7] | |
|
NHS Probe Info |
![]() |
K58(0.00); K47(0.00); K117(0.00); K6(0.00) | LDD0010 | [8] | |
|
W1 Probe Info |
![]() |
E114(0.00); Y84(0.00); H50(0.00); H110(0.00) | LDD0236 | [9] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0116 | HHS-0101 | DM93 | Y84(1.13) | LDD0264 | [4] |
| LDCM0117 | HHS-0201 | DM93 | Y84(1.00) | LDD0265 | [4] |
| LDCM0118 | HHS-0301 | DM93 | Y84(1.27) | LDD0266 | [4] |
| LDCM0119 | HHS-0401 | DM93 | Y84(1.26) | LDD0267 | [4] |
| LDCM0120 | HHS-0701 | DM93 | Y84(1.74) | LDD0268 | [4] |
| LDCM0123 | JWB131 | DM93 | Y84(1.47) | LDD0285 | [3] |
| LDCM0124 | JWB142 | DM93 | Y84(1.16) | LDD0286 | [3] |
| LDCM0125 | JWB146 | DM93 | Y84(2.41) | LDD0287 | [3] |
| LDCM0126 | JWB150 | DM93 | Y84(6.21) | LDD0288 | [3] |
| LDCM0127 | JWB152 | DM93 | Y84(2.74) | LDD0289 | [3] |
| LDCM0128 | JWB198 | DM93 | Y84(3.99) | LDD0290 | [3] |
| LDCM0129 | JWB202 | DM93 | Y84(1.54) | LDD0291 | [3] |
| LDCM0130 | JWB211 | DM93 | Y84(2.02) | LDD0292 | [3] |
| LDCM0109 | NEM | HeLa | N.A. | LDD0223 | [6] |
| LDCM0110 | W12 | Hep-G2 | H110(0.50); R87(0.59); N85(0.59); Q48(1.05) | LDD0237 | [9] |
| LDCM0111 | W14 | Hep-G2 | H83(0.96); H50(1.14) | LDD0238 | [9] |
| LDCM0112 | W16 | Hep-G2 | E106(0.86); K47(0.94); D52(0.97); Q48(0.97) | LDD0239 | [9] |
| LDCM0113 | W17 | Hep-G2 | N85(0.55); S57(1.35); H50(1.38); Q48(1.41) | LDD0240 | [9] |
The Interaction Atlas With This Target
References











