General Information of Target

Target ID LDTP04144
Target Name Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1)
Gene Name UQCRFS1
Gene ID 7386
Synonyms
Cytochrome b-c1 complex subunit Rieske, mitochondrial; EC 7.1.1.8; Complex III subunit 5; Cytochrome b-c1 complex subunit 5; Rieske iron-sulfur protein; RISP; Rieske protein UQCRFS1; Ubiquinol-cytochrome c reductase iron-sulfur subunit) [Cleaved into: Cytochrome b-c1 complex subunit 9; Su9; Subunit 9; 8 kDa subunit 9; Complex III subunit IX; Cytochrome b-c1 complex subunit 11; UQCRFS1 mitochondrial targeting sequence; UQCRFS1 MTS; Ubiquinol-cytochrome c reductase 8 kDa protein)]
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAV
RRPLVASVGLNVPASVCYSHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGV
TTVGVAYAAKNAVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRT
QKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHG
SHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG
Target Bioclass
Enzyme
Family
Rieske iron-sulfur protein family
Subcellular location
Mitochondrion inner membrane
Function
[Cytochrome b-c1 complex subunit Rieske, mitochondrial]: Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, linking this redox reaction to translocation of protons across the mitochondrial inner membrane, with protons being carried across the membrane as hydrogens on the quinol. In the process called Q cycle, 2 protons are consumed from the matrix, 4 protons are released into the intermembrane space and 2 electrons are passed to cytochrome c. The Rieske protein is a catalytic core subunit containing a [2Fe-2S] iron-sulfur cluster. It cycles between 2 conformational states during catalysis to transfer electrons from the quinol bound in the Q(0) site in cytochrome b to cytochrome c1. Incorporation of UQCRFS1 is the penultimate step in complex III assembly.; [Cytochrome b-c1 complex subunit 9]: Component of the ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII). UQCRFS1 undergoes proteolytic processing once it is incorporated in the complex III dimer. One of the fragments, called subunit 9, corresponds to its mitochondrial targeting sequence (MTS). The proteolytic processing is necessary for the correct insertion of UQCRFS1 in the complex III dimer, but the persistence of UQCRFS1-derived fragments may prevent newly imported UQCRFS1 to be processed and assembled into complex III and is detrimental for the complex III structure and function.
Uniprot ID
P47985
Ensemble ID
ENST00000304863.6
HGNC ID
HGNC:12587

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 10 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
CY-1
 Probe Info 
100.00  LDD0243  [1]
CY4
 Probe Info 
100.00  LDD0244  [1]
FBP2
 Probe Info 
2.74  LDD0323  [2]
YN-1
 Probe Info 
100.00  LDD0444  [3]
m-APA
 Probe Info 
14.85  LDD0403  [4]
Acrolein
 Probe Info 
N.A.  LDD0227  [5]
5E-2FA
 Probe Info 
N.A.  LDD2235  [6]
NHS
 Probe Info 
N.A.  LDD0010  [7]
TER-AC
 Probe Info 
N.A.  LDD0426  [8]
TPP-AC
 Probe Info 
N.A.  LDD0427  [8]
PAL-AfBPP Probe
Click To Hide/Show 10 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C070
 Probe Info 
13.55  LDD1766  [9]
C095
 Probe Info 
5.43  LDD1786  [9]
C271
 Probe Info 
7.16  LDD1941  [9]
C278
 Probe Info 
59.71  LDD1948  [9]
C426
 Probe Info 
13.45  LDD2081  [9]
FFF probe11
 Probe Info 
14.28  LDD0471  [10]
FFF probe13
 Probe Info 
20.00  LDD0475  [10]
FFF probe14
 Probe Info 
13.35  LDD0477  [10]
FFF probe2
 Probe Info 
17.16  LDD0463  [10]
FFF probe3
 Probe Info 
5.63  LDD0480  [10]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0156  Aniline NCI-H1299 14.85  LDD0403  [4]
 LDCM0109  NEM HeLa N.A.  LDD0227  [5]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Complex III assembly factor LYRM7 (LYRM7) Complex I LYR family Q5U5X0

The Drug(s) Related To This Target

Investigative
Click To Hide/Show 9 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
2-nonyl-4-quinolinol 1-oxide Small molecular drug DB08453
5-heptyl-6-hydroxy-13-benzothiazole-47-dione Small molecular drug DB07636
6-hydroxy-5-undecyl-47-benzothiazoledione Small molecular drug DB04799
Ubiquinone Q2 Small molecular drug DB08690
(5s)-3-anilino-5-(24-difluorophenyl)-5-methyl-13-oxazolidine-24-dione . DB07763
(S)-famoxadone . DB07778
2-hexyloxy-6-hydroxymethyl-tetrahydro-pyran-345-triol . DB04141
Azoxystrobin . DB07401
Methyl (2z)-3-methoxy-2-{2-[(E)-2-phenylvinyl]Phenyl}Acrylate . DB08330

References

1 Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.
2 Tranylcypromine specificity for monoamine oxidase is limited by promiscuous protein labelling and lysosomal trapping. RSC Chem Biol. 2020 Aug 12;1(4):209-213. doi: 10.1039/d0cb00048e. eCollection 2020 Oct 1.
Mass spectrometry data entry: PXD018580
3 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
4 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
5 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
6 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
7 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
8 Differently Tagged Probes for Protein Profiling of Mitochondria. Chembiochem. 2019 May 2;20(9):1155-1160. doi: 10.1002/cbic.201800735. Epub 2019 Mar 26.
9 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
10 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.