Details of the Target

General Information of Target

Target ID LDTP03213
Target Name Tubulin gamma-1 chain (TUBG1)
Gene Name TUBG1
Gene ID 7283
Synonyms
TUBG; Tubulin gamma-1 chain; Gamma-1-tubulin; Gamma-tubulin complex component 1; GCP-1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHY
IPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFD
IIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSD
VVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSAST
TTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQP
KNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVAL
SRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDE
MDTSREIVQQLIDEYHAATRPDYISWGTQEQ
Target Bioclass
Other
Family
Tubulin family
Subcellular location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome
Function
Tubulin is the major constituent of microtubules. The gamma chain is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome. Pericentriolar matrix component that regulates alpha/beta chain minus-end nucleation, centrosome duplication and spindle formation.
Uniprot ID
P23258
Ensemble ID
ENST00000251413.8
HGNC ID
HGNC:12417

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 22 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TH211
 Probe Info  		Y86(10.28); Y273(8.14); Y53(5.50)  LDD0257  [1]
TH216
 Probe Info  		Y86(6.46); Y82(5.80)  LDD0259  [1]
STPyne
 Probe Info  		K287(8.59); K301(8.33)  LDD0277  [2]
Probe 1
 Probe Info  		Y161(37.54)  LDD3495  [3]
HHS-482
 Probe Info  		Y82(1.34)  LDD0285  [4]
HHS-475
 Probe Info  		Y53(1.08)  LDD0264  [5]
5E-2FA
 Probe Info  		N.A.  LDD2235  [6]
m-APA
 Probe Info  		N.A.  LDD2231  [6]
4-Iodoacetamidophenylacetylene
 Probe Info  		C138(0.00); C201(0.00); C26(0.00); C316(0.00)  LDD0038  [7]
IA-alkyne
 Probe Info  		C138(0.00); C201(0.00); C316(0.00); C26(0.00)  LDD0036  [7]
IPIAA_L
 Probe Info  		N.A.  LDD0031  [8]
Lodoacetamide azide
 Probe Info  		C138(0.00); C13(0.00); C201(0.00); C316(0.00)  LDD0037  [7]
IPM
 Probe Info  		N.A.  LDD0025  [9]
JW-RF-010
 Probe Info  		N.A.  LDD0026  [9]
NAIA_4
 Probe Info  		C138(0.00); C201(0.00)  LDD2226  [10]
TFBX
 Probe Info  		N.A.  LDD0027  [9]
SF
 Probe Info  		N.A.  LDD0028  [11]
1c-yne
 Probe Info  		K301(0.00); K84(0.00); K344(0.00); K164(0.00)  LDD0228  [12]
Acrolein
 Probe Info  		C201(0.00); H115(0.00); H59(0.00)  LDD0217  [13]
Methacrolein
 Probe Info  		N.A.  LDD0218  [13]
AOyne
 Probe Info  		8.80  LDD0443  [14]
NAIA_5
 Probe Info  		C316(0.00); C26(0.00); C392(0.00)  LDD2223  [10]
PAL-AfBPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C249
 Probe Info  		12.04  LDD1922  [15]
FFF probe13
 Probe Info  		5.03  LDD0475  [16]
FFF probe2
 Probe Info  		7.48  LDD0463  [16]
VE-P
 Probe Info  		N.A.  LDD0396  [17]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0025  4SU-RNA HEK-293T C138(3.33); C316(2.26)  LDD0371  [18]
 LDCM0026  4SU-RNA+native RNA HEK-293T C138(5.88)  LDD0372  [18]
 LDCM0630  CCW28-3 231MFP C13(1.57)  LDD2214  [19]
 LDCM0108  Chloroacetamide HeLa C201(0.00); H115(0.00); H59(0.00); H29(0.00)  LDD0222  [13]
 LDCM0632  CL-Sc Hep-G2 C316(20.00)  LDD2227  [10]
 LDCM0625  F8 Ramos C201(0.96)  LDD2187  [20]
 LDCM0572  Fragment10 Ramos C201(0.79)  LDD2189  [20]
 LDCM0573  Fragment11 Ramos C201(0.11)  LDD2190  [20]
 LDCM0574  Fragment12 Ramos C201(1.10)  LDD2191  [20]
 LDCM0575  Fragment13 Ramos C201(0.97)  LDD2192  [20]
 LDCM0576  Fragment14 Ramos C201(1.17)  LDD2193  [20]
 LDCM0579  Fragment20 Ramos C201(1.13)  LDD2194  [20]
 LDCM0580  Fragment21 Ramos C201(1.33)  LDD2195  [20]
 LDCM0582  Fragment23 Ramos C201(0.89)  LDD2196  [20]
 LDCM0578  Fragment27 Ramos C201(0.96)  LDD2197  [20]
 LDCM0586  Fragment28 Ramos C201(1.39)  LDD2198  [20]
 LDCM0588  Fragment30 Ramos C201(0.92)  LDD2199  [20]
 LDCM0589  Fragment31 Ramos C201(1.09)  LDD2200  [20]
 LDCM0590  Fragment32 Ramos C201(0.86)  LDD2201  [20]
 LDCM0468  Fragment33 Ramos C201(1.08)  LDD2202  [20]
 LDCM0596  Fragment38 Ramos C201(1.17)  LDD2203  [20]
 LDCM0566  Fragment4 Ramos C201(0.99)  LDD2184  [20]
 LDCM0610  Fragment52 Ramos C201(0.74)  LDD2204  [20]
 LDCM0614  Fragment56 Ramos C201(1.00)  LDD2205  [20]
 LDCM0569  Fragment7 Ramos C201(1.04)  LDD2186  [20]
 LDCM0571  Fragment9 Ramos C201(1.03)  LDD2188  [20]
 LDCM0116  HHS-0101 DM93 Y53(1.08)  LDD0264  [5]
 LDCM0117  HHS-0201 DM93 Y53(1.22)  LDD0265  [5]
 LDCM0118  HHS-0301 DM93 Y53(1.95)  LDD0266  [5]
 LDCM0119  HHS-0401 DM93 Y53(1.31)  LDD0267  [5]
 LDCM0120  HHS-0701 DM93 Y53(1.47)  LDD0268  [5]
 LDCM0107  IAA HeLa C201(0.00); H59(0.00); H115(0.00)  LDD0221  [13]
 LDCM0123  JWB131 DM93 Y82(1.34)  LDD0285  [4]
 LDCM0124  JWB142 DM93 Y82(0.33)  LDD0286  [4]
 LDCM0125  JWB146 DM93 Y82(1.43)  LDD0287  [4]
 LDCM0126  JWB150 DM93 Y82(2.67)  LDD0288  [4]
 LDCM0127  JWB152 DM93 Y82(2.51)  LDD0289  [4]
 LDCM0128  JWB198 DM93 Y82(2.75)  LDD0290  [4]
 LDCM0129  JWB202 DM93 Y82(0.45)  LDD0291  [4]
 LDCM0130  JWB211 DM93 Y82(0.92)  LDD0292  [4]
 LDCM0022  KB02 Ramos C201(1.04)  LDD2182  [20]
 LDCM0023  KB03 Ramos C201(1.10)  LDD2183  [20]
 LDCM0024  KB05 Ramos C201(0.97)  LDD2185  [20]
 LDCM0109  NEM HeLa H59(0.00); H115(0.00); H267(0.00); H75(0.00)  LDD0223  [13]
 LDCM0627  NUDT7-COV-1 HEK-293T C13(0.36)  LDD2206  [21]
 LDCM0628  OTUB2-COV-1 HEK-293T C13(0.49)  LDD2207  [21]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
MAP/microtubule affinity-regulating kinase 4 (MARK4) CAMK Ser/Thr protein kinase family Q96L34
Other
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Mitotic-spindle organizing protein 1 (MZT1) MOZART1 family Q08AG7
Mitotic-spindle organizing protein 2B (MZT2B) MOZART2 family Q6NZ67
Tubulin gamma-1 chain (TUBG1) Tubulin family P23258
Axin-1 (AXIN1) . O15169

The Drug(s) Related To This Target

Approved
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Vinblastine Small molecular drug DB00570

References

1 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
4 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
5 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
6 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
7 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
8 SP3-Enabled Rapid and High Coverage Chemoproteomic Identification of Cell-State-Dependent Redox-Sensitive Cysteines. Mol Cell Proteomics. 2022 Apr;21(4):100218. doi: 10.1016/j.mcpro.2022.100218. Epub 2022 Feb 25.
Mass spectrometry data entry: PXD029500 , PXD031647
9 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
10 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
11 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
12 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
13 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
14 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
15 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
16 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.
17 Pharmacological Targeting of Vacuolar H(+)-ATPase via Subunit V1G Combats Multidrug-Resistant Cancer. Cell Chem Biol. 2020 Nov 19;27(11):1359-1370.e8. doi: 10.1016/j.chembiol.2020.06.011. Epub 2020 Jul 9.
18 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
19 Covalent Ligand Screening Uncovers a RNF4 E3 Ligase Recruiter for Targeted Protein Degradation Applications. ACS Chem Biol. 2019 Nov 15;14(11):2430-2440. doi: 10.1021/acschembio.8b01083. Epub 2019 May 13.
20 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
21 Rapid Covalent-Probe Discovery by Electrophile-Fragment Screening. J Am Chem Soc. 2019 Jun 5;141(22):8951-8968. doi: 10.1021/jacs.9b02822. Epub 2019 May 22.