Details of the Target

General Information of Target

Target ID LDTP03109
Target Name Amine oxidase [flavin-containing] A (MAOA)
Gene Name MAOA
Gene ID 4128
Synonyms
Amine oxidase [flavin-containing] A; EC 1.4.3.21; EC 1.4.3.4; Monoamine oxidase type A; MAO-A
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
Target Type
Successful
Target Bioclass
Enzyme
Family
Flavin monoamine oxidase family
Subcellular location
Mitochondrion outer membrane
Function
Catalyzes the oxidative deamination of primary and some secondary amine such as neurotransmitters, with concomitant reduction of oxygen to hydrogen peroxide and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. Preferentially oxidizes serotonin. Also catalyzes the oxidative deamination of kynuramine to 3-(2-aminophenyl)-3-oxopropanal that can spontaneously condense to 4-hydroxyquinoline.
TTD ID
T83875
Uniprot ID
P21397
DrugMap ID
TT3WG5C
Ensemble ID
ENST00000338702.4
HGNC ID
HGNC:6833
ChEMBL ID
CHEMBL1951

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CASKI SNV: p.E5D .
HCC1395 SNV: p.D15E .
HCT15 SNV: p.G452E .
IGROV1 SNV: p.I486N .
NUGC3 SNV: p.Q425P .
REH SNV: p.S24Ter .
SNGM SNV: p.S184A .
SNU1 SNV: p.R229W .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 9 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
FBPP2
 Probe Info  		2.92  LDD0318  [1]
FBP2
 Probe Info  		3.56  LDD0317  [1]
STPyne
 Probe Info  		K104(9.09); K372(1.73)  LDD0277  [2]
P11
 Probe Info  		20.00  LDD0201  [3]
Alkylaryl probe 3
 Probe Info  		20.00  LDD0282  [4]
BTD
 Probe Info  		C374(1.24)  LDD2136  [5]
IPM
 Probe Info  		C201(4.91)  LDD1701  [5]
DBIA
 Probe Info  		C374(1.15)  LDD0547  [6]
IA-alkyne
 Probe Info  		N.A.  LDD0165  [7]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0230  AC113 HCT 116 C374(1.15)  LDD0547  [6]
 LDCM0231  AC114 HCT 116 C374(1.20)  LDD0548  [6]
 LDCM0232  AC115 HCT 116 C374(1.18)  LDD0549  [6]
 LDCM0233  AC116 HCT 116 C374(1.32)  LDD0550  [6]
 LDCM0234  AC117 HCT 116 C374(1.33)  LDD0551  [6]
 LDCM0235  AC118 HCT 116 C374(1.20)  LDD0552  [6]
 LDCM0236  AC119 HCT 116 C374(1.51)  LDD0553  [6]
 LDCM0238  AC120 HCT 116 C374(1.36)  LDD0555  [6]
 LDCM0239  AC121 HCT 116 C374(1.17)  LDD0556  [6]
 LDCM0240  AC122 HCT 116 C374(1.36)  LDD0557  [6]
 LDCM0241  AC123 HCT 116 C374(1.28)  LDD0558  [6]
 LDCM0242  AC124 HCT 116 C374(1.43)  LDD0559  [6]
 LDCM0243  AC125 HCT 116 C374(1.32)  LDD0560  [6]
 LDCM0244  AC126 HCT 116 C374(1.18)  LDD0561  [6]
 LDCM0245  AC127 HCT 116 C374(1.45)  LDD0562  [6]
 LDCM0296  AC35 HCT 116 C374(1.02)  LDD0613  [6]
 LDCM0297  AC36 HCT 116 C374(0.99)  LDD0614  [6]
 LDCM0298  AC37 HCT 116 C374(0.96)  LDD0615  [6]
 LDCM0299  AC38 HCT 116 C374(0.88)  LDD0616  [6]
 LDCM0300  AC39 HCT 116 C374(0.90)  LDD0617  [6]
 LDCM0302  AC40 HCT 116 C374(0.89)  LDD0619  [6]
 LDCM0303  AC41 HCT 116 C374(0.69)  LDD0620  [6]
 LDCM0304  AC42 HCT 116 C374(0.76)  LDD0621  [6]
 LDCM0305  AC43 HCT 116 C374(0.74)  LDD0622  [6]
 LDCM0306  AC44 HCT 116 C374(0.62)  LDD0623  [6]
 LDCM0307  AC45 HCT 116 C374(0.69)  LDD0624  [6]
 LDCM0320  AC57 HCT 116 C374(0.98)  LDD0637  [6]
 LDCM0321  AC58 HCT 116 C374(0.92)  LDD0638  [6]
 LDCM0322  AC59 HCT 116 C374(0.87)  LDD0639  [6]
 LDCM0324  AC60 HCT 116 C374(0.87)  LDD0641  [6]
 LDCM0325  AC61 HCT 116 C374(0.92)  LDD0642  [6]
 LDCM0326  AC62 HCT 116 C374(0.82)  LDD0643  [6]
 LDCM0327  AC63 HCT 116 C374(0.88)  LDD0644  [6]
 LDCM0328  AC64 HCT 116 C374(0.87)  LDD0645  [6]
 LDCM0329  AC65 HCT 116 C374(0.93)  LDD0646  [6]
 LDCM0330  AC66 HCT 116 C374(0.90)  LDD0647  [6]
 LDCM0331  AC67 HCT 116 C374(0.88)  LDD0648  [6]
 LDCM0332  AC68 HCT 116 C374(0.97)  LDD0649  [6]
 LDCM0333  AC69 HCT 116 C374(1.03)  LDD0650  [6]
 LDCM0335  AC70 HCT 116 C374(1.21)  LDD0652  [6]
 LDCM0336  AC71 HCT 116 C374(1.15)  LDD0653  [6]
 LDCM0337  AC72 HCT 116 C374(1.21)  LDD0654  [6]
 LDCM0338  AC73 HCT 116 C374(1.18)  LDD0655  [6]
 LDCM0339  AC74 HCT 116 C374(1.16)  LDD0656  [6]
 LDCM0340  AC75 HCT 116 C374(1.29)  LDD0657  [6]
 LDCM0341  AC76 HCT 116 C374(1.13)  LDD0658  [6]
 LDCM0342  AC77 HCT 116 C374(1.22)  LDD0659  [6]
 LDCM0343  AC78 HCT 116 C374(1.32)  LDD0660  [6]
 LDCM0344  AC79 HCT 116 C374(1.31)  LDD0661  [6]
 LDCM0346  AC80 HCT 116 C374(1.23)  LDD0663  [6]
 LDCM0347  AC81 HCT 116 C374(1.21)  LDD0664  [6]
 LDCM0348  AC82 HCT 116 C374(1.29)  LDD0665  [6]
 LDCM0349  AC83 HCT 116 C374(1.04)  LDD0666  [6]
 LDCM0350  AC84 HCT 116 C374(0.92)  LDD0667  [6]
 LDCM0351  AC85 HCT 116 C374(0.89)  LDD0668  [6]
 LDCM0352  AC86 HCT 116 C374(0.91)  LDD0669  [6]
 LDCM0353  AC87 HCT 116 C374(0.96)  LDD0670  [6]
 LDCM0354  AC88 HCT 116 C374(1.01)  LDD0671  [6]
 LDCM0355  AC89 HCT 116 C374(0.93)  LDD0672  [6]
 LDCM0357  AC90 HCT 116 C374(1.01)  LDD0674  [6]
 LDCM0358  AC91 HCT 116 C374(0.95)  LDD0675  [6]
 LDCM0359  AC92 HCT 116 C374(0.74)  LDD0676  [6]
 LDCM0360  AC93 HCT 116 C374(0.86)  LDD0677  [6]
 LDCM0361  AC94 HCT 116 C374(1.14)  LDD0678  [6]
 LDCM0362  AC95 HCT 116 C374(1.08)  LDD0679  [6]
 LDCM0363  AC96 HCT 116 C374(0.90)  LDD0680  [6]
 LDCM0364  AC97 HCT 116 C374(1.10)  LDD0681  [6]
 LDCM0088  C45 HEK-293T 20.00  LDD0201  [3]
 LDCM0387  CL117 HCT 116 C374(0.86)  LDD0704  [6]
 LDCM0388  CL118 HCT 116 C374(0.91)  LDD0705  [6]
 LDCM0389  CL119 HCT 116 C374(0.91)  LDD0706  [6]
 LDCM0391  CL120 HCT 116 C374(0.74)  LDD0708  [6]
 LDCM0396  CL125 HCT 116 C374(0.99)  LDD0713  [6]
 LDCM0397  CL126 HCT 116 C374(1.00)  LDD0714  [6]
 LDCM0398  CL127 HCT 116 C374(0.84)  LDD0715  [6]
 LDCM0399  CL128 HCT 116 C374(0.98)  LDD0716  [6]
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C201(3.60)  LDD1702  [5]
 LDCM0022  KB02 BRX394 C374(1.60)  LDD2274  [8]
 LDCM0023  KB03 MDA-MB-231 C201(4.91)  LDD1701  [5]
 LDCM0024  KB05 BRX29 C306(1.81); C374(1.65)  LDD3104  [8]
 LDCM0543  Nucleophilic fragment 38 MDA-MB-231 C374(1.24)  LDD2136  [5]
 LDCM0099  Phenelzine HEK-293T 20.00  LDD0282  [4]
 LDCM0008  Tranylcypromine HeLa 9.22  LDD0320  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Amine oxidase [flavin-containing] B (MAOB) Flavin monoamine oxidase family P27338

The Drug(s) Related To This Target

Approved
Click To Hide/Show 47 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Almotriptan Small molecular drug DB00918
Amphetamine Small molecular drug DB00182
Betahistine Small molecular drug DB06698
Capsaicin Small molecular drug DB06774
Clorgyline Small molecular drug D09QDP
Dopamine Small molecular drug DB00988
Epinephrine Small molecular drug DB00668
Eravacycline Small molecular drug DB12329
Escitalopram Small molecular drug DB01175
Flavin Adenine Dinucleotide Small molecular drug DB03147
Ginkgo Biloba Small molecular drug DB01381
Isocarboxazid Small molecular drug D0I2VK
Metamfetamine Small molecular drug DB01577
Minaprine Small molecular drug DB00805
Moclobemide Small molecular drug D01ZSO
Nandrolone Decanoate Small molecular drug DB08804
Naratriptan Small molecular drug DB00952
Nicotine Small molecular drug DB00184
Nomifensine Small molecular drug DB04821
Oxymetholone Small molecular drug DB06412
Pargyline Small molecular drug DB01626
Phenelzine Small molecular drug DB00780
Phentermine Small molecular drug DB00191
Phenylephrine Small molecular drug DB00388
Phenylpropanolamine Small molecular drug DB00397
Procaine Small molecular drug DB00721
Propranolol Small molecular drug DB00571
Pseudoephedrine Small molecular drug DB00852
Riboflavin Small molecular drug DB00140
Rizatriptan Small molecular drug DB00953
Safinamide Small molecular drug DB06654
Selegiline Small molecular drug DB01037
Sertraline Small molecular drug DB01104
Sumatriptan Small molecular drug DB00669
Testosterone Small molecular drug DB00624
Testosterone Undecanoate Small molecular drug DB13946
Tranylcypromine Small molecular drug D0H0HJ
Ubrogepant Small molecular drug DB15328
Zimelidine Small molecular drug DB04832
Zolmitriptan Small molecular drug DB00315
Zonisamide Small molecular drug DB00909
Copper . DB09130
Flortaucipir F-18 . DB14914
Nialamide . DB04820
Testosterone Cypionate . DB13943
Testosterone Enanthate . DB13944
Viloxazine . DB09185
Phase 3
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Psoralen Small molecular drug D00VUI
Tryptamine Small molecular drug D08CJK
Phase 2
Click To Hide/Show 4 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Chf-3381 Small molecular drug D04RCT
Cx157 Small molecular drug D00RWQ
Ladostigil Small molecular drug D0C3UC
Piperine Small molecular drug D0H7PW
Phase 1
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Desoxypeganine Small molecular drug D0T5AW
Investigative
Click To Hide/Show 185 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
(+/-)-2-(4'-benzyloxyphenyl)Thiomorpholine Small molecular drug D0D6OR
(+/-)-2-(4'-butoxyphenyl)Thiomorpholin-5-one Small molecular drug D0M4GR
(+/-)-2-(4'-butoxyphenyl)Thiomorpholine Small molecular drug D0T3XC
(+/-)-2-(4'-ethoxyphenyl)Thiomorpholin-5-one Small molecular drug D0D5KD
(+/-)-2-(4'-ethoxyphenyl)Thiomorpholine Small molecular drug D0J0QW
(+/-)-2-(4'-methoxyphenyl)Thiomorpholin-5-one Small molecular drug D0ID3Y
(+/-)-2-(4'-methoxyphenyl)Thiomorpholine Small molecular drug D08TFN
(+/-)-2-(4'-propoxyphenyl)Thiomorpholin-5-one Small molecular drug D0Z5BU
(+/-)-2-(4'-propoxyphenyl)Thiomorpholine Small molecular drug D08FXH
(+/-)-2-phenylthiomorpholin-5-one Small molecular drug D04FLL
(+/-)-2-phenylthiomorpholine Small molecular drug D0HU4J
(6-benzyloxy-2-naphthyl)-2-aminopropane Small molecular drug D03HXD
(6-butoxy-2-naphthyl)-2-aminopropane Small molecular drug D0V7RM
(6-ethoxy-2-naphthyl)-2-aminopropane Small molecular drug D0L5EW
(6-methoxy-2-naphthyl)-2-aminopropane Small molecular drug D02IDM
(6-methylthio-2-naphthyl)Isopropylamine Small molecular drug D0R4TI
(6-propoxy-2-naphthyl)-2-aminopropane Small molecular drug D0IP7L
(7-benzyloxy-2-oxo-2h-chromen-4-yl)Acetonitrile Small molecular drug D02TFD
(E)-5-(3-chlorostyryl)Isatin Small molecular drug D06AJP
(E)-5-(3-fluorostyryl)Isatin Small molecular drug D0X8HH
(E)-5-styrylisatin Small molecular drug D09XSB
(R,S)-n-(R-phenylethyl)-1h-pyrrole-2-carboxamide Small molecular drug D04UYZ
(R/R)Befloxatone Small molecular drug D0M0XR
(S)-2-amino-1-(4-butylthiophenyl)-propane Small molecular drug D0Z0ZU
(S)-2-amino-1-(4-ethylthiophenyl)-propane Small molecular drug D02ZZA
(S)-2-amino-1-(4-methylthiophenyl)-propane Small molecular drug D0Q2QA
(S)-2-amino-1-(4-propylthiophenyl)-propane Small molecular drug D08SSS
1,2,3,4-tetrahydro-pyrazino[1,2-a]Indole Small molecular drug D0C1SE
1-(1-naphthyl)-2-aminopropane Small molecular drug D0BE0S
1-(2-naphthyl)-2-aminopropane Small molecular drug D00YVE
1-(3-(4-chlorobenzyl)Quinoxalin-2-yl)Hydrazine Small molecular drug D0B5CR
1-(3-benzyl-6,7-dichloroquinoxalin-2-yl)Hydrazine Small molecular drug D0WI3V
1-(3-benzylquinoxalin-2-yl)Hydrazine Small molecular drug D0O4XF
1-(4-(Benzyloxy)Phenyl)Propan-2-amine Small molecular drug D01SBZ
1-(4-butoxyphenyl)Propan-2-amine Small molecular drug D00KQB
1-(4-ethoxyphenyl)Propan-2-amine Small molecular drug D0X0PA
1-(4-propoxyphenyl)Propan-2-amine Small molecular drug D0H6UA
2,3,4,5-tetrahydro-1h-pyrido[4,3-b]Indole Small molecular drug D0M7WE
2-(2-cycloheptylidenehydrazinyl)-4-phenylthiazole Small molecular drug D0Q1IP
2-(2-cyclopentylidenehydrazinyl)-4-phenylthiazole Small molecular drug D00WVG
2-(3,4-dimethoxyphenyl)-4,5-dihydro-1h-imidazole Small molecular drug D0C0MP
2-(3-benzylquinoxalin-2-ylamino)Ethanol Small molecular drug D0H1GQ
2-(4,5-dihydro-1h-imidazol-2-yl)Quinoline Small molecular drug D0A4AB
2-(4-methoxyphenyl)-4,5-dihydro-1h-imidazole Small molecular drug D0K8SK
2-(5-phenyl-furan-2-yl)-4,5-dihydro-1h-imidazole Small molecular drug D0P1UC
2-(Naphthalen-2-yl)-4,5-dihydro-1h-imidazole Small molecular drug D04ZPU
2-amino-1-(4-methylthiophenyl)Propane Small molecular drug D08SCH
2-bfi Small molecular drug D0LI3J
2-bromo-n-(2-morpholinoethyl)Nicotinamide Small molecular drug D02BBT
2-chloro-n-(2-morpholinoethyl)Nicotinamide Small molecular drug D0R5EW
2-chloro-n-(3-morpholinopropyl)Nicotinamide Small molecular drug D0NS9X
2-furan-2-yl-4,5-dihydro-1h-imidazole Small molecular drug D09ZDQ
2-oxo-n-m-tolyl-2h-chromene-3-carboxamide Small molecular drug D00WSM
2-oxo-n-p-tolyl-2h-chromene-3-carboxamide Small molecular drug D0H0GZ
2-oxo-n-phenyl-2h-chromene-3-carboxamide Small molecular drug D03PXS
2-phenethyl-4,5-dihydro-1h-imidazole Small molecular drug D0Z7NC
2-phenoxymethyl-4,5-dihydro-1h-imidazole Small molecular drug D0N9FH
2-phenyl-5h-indeno[1,2-d]Pyrimidine Small molecular drug D0W3BX
2-phenyl-9h-indeno[2,1-d]Pyrimidine Small molecular drug D0Q9NC
2-[7-(Benzyloxy)-2-oxo-2h-chromen-4-yl]Acetamide Small molecular drug D0S3QN
3,4-benzo-7-(Beta-bromoallyloxy)-8-methylcoumarin Small molecular drug D0P4GF
3,4-benzo-7-acetonyloxy-8-methoxycoumarin Small molecular drug D0TL3S
3,4-benzo-7-acetonyloxy-8-methylcoumarin Small molecular drug D0Y1XS
3,4-dichloro-n-(2-methyl-1h-indol-5-yl)Benzamide Small molecular drug D09NNZ
3-aminoacetamido-4'-methylfuro[3,2-g]Coumarin Small molecular drug D0O0QN
3-benzyl-n-(2-morpholinoethyl)Quinoxalin-2-amine Small molecular drug D0KW6V
3-chloro-n-(2-methyl-1h-indol-5-yl)Benzamide Small molecular drug D0D6QI
3-methyl-2(1h)-thioxo-4(3h)-quinazolinone Small molecular drug D0P0XO
4,8-dimethyl-7-(2'-oxocyclohexyloxy)Coumarin Small molecular drug D01LUB
4,9-dihydro-3h-beta-carboline Small molecular drug D0G8BT
4-(2-oxo-2h-chromene-3-carboxamido)Benzoic Acid Small molecular drug D0E8IE
4-(Aminomethyl)-7-(Benzyloxy)-2h-chromen-2-one Small molecular drug D0T1FJ
4-chloro-n-(2-morpholinoethyl)Nicotinamide Small molecular drug D0S9JC
4-chloro-n-(3-morpholinopropyl)Nicotinamide Small molecular drug D06IAE
4-methyl-2h-benzofuro[3,2-g]Chromen-2-one Small molecular drug D00JUD
4-methyl-7-(2-oxocyclopentyloxy)-2h-chromen-2-one Small molecular drug D0A1RE
5,6-dichloro-n-(2-morpholinoethyl)Nicotinamide Small molecular drug D0J3IA
5,6-dichloro-n-(3-morpholinopropyl)Nicotinamide Small molecular drug D0ZA4J
5-azidomethyl-3-pyrrol-1-yl-oxazolidin-2-one Small molecular drug D07LCW
5-bromo-2,3,4,9-tetrahydro-1h-beta-carboline Small molecular drug D0L8ND
5-bromo-4,9-dihydro-3h-beta-carboline Small molecular drug D08HAM
5-hydroxymethyl-3-pyrrol-1-yl-oxazolidin-2-one Small molecular drug D08QVY
5-methoxy-2,3,4,9-tetrahydro-1h-beta-carboline Small molecular drug D00NSA
5-methoxy-4,9-dihydro-3h-beta-carboline Small molecular drug D0V6XA
5-methoxymethyl-3-pyrrol-1-yl-oxazolidin-2-one Small molecular drug D06FXI
6,11-dihydro-5h-benzo[A]Carbazole Small molecular drug D0E5VT
6-amino-9-methoxy-7h-furo[3,2-g]Chromen-7-one Small molecular drug D0S0JH
6-bromo-2,3,4,9-tetrahydro-1h-beta-carboline Small molecular drug D05GQQ
6-bromo-4,9-dihydro-3h-beta-carboline Small molecular drug D04GVX
6-chloro-n-(2-morpholinoethyl)Nicotinamide Small molecular drug D05GGH
6-chloro-n-(3-morpholinopropyl)Nicotinamide Small molecular drug D04SJC
6-fluoro-n-(2-morpholinoethyl)Nicotinamide Small molecular drug D04EDK
6-hydroxy-n-(2-morpholinoethyl)Nicotinamide Small molecular drug D0D0SC
6-methoxy-2,3,4,9-tetrahydro-1h-beta-carboline Small molecular drug D0J3SN
6-methoxy-4,9-dihydro-3h-beta-carboline Small molecular drug D0C7PD
7-(3-chlorobenzyloxy)-4-carboxaldehyde-coumarin Small molecular drug D0C9WW
7-acetonyloxy-3,4-cyclohexene-8-methylcoumarin Small molecular drug D08FFH
7-acetonyloxy-3,4-cyclopentene-8-methylcoumarin Small molecular drug D00OQL
7-acetonyloxy-3-acetylamino-8-methoxycoumarin Small molecular drug D0R4PR
7-bromo-2,3,4,9-tetrahydro-1h-beta-carboline Small molecular drug D02UVG
7-bromo-4,9-dihydro-3h-beta-carboline Small molecular drug D0W4TW
7-methoxy-2,3,4,9-tetrahydro-1h-beta-carboline Small molecular drug D05GDP
7-methoxy-9h-beta-carboline Small molecular drug D05FQN
8-(3-bromobenzyloxy)Caffeine Small molecular drug D07NBB
8-(3-chlorobenzyloxy)Caffeine Small molecular drug D08YCE
8-(3-fluorobenzyloxy)Caffeine Small molecular drug D04LPY
8-(3-methoxybenzyloxy)Caffeine Small molecular drug D0B6MV
8-(3-methylbenzyloxy)Caffeine Small molecular drug D00OLX
8-benzyloxycaffeine Small molecular drug D0JN9R
8-bromo-2,3,4,9-tetrahydro-1h-beta-carboline Small molecular drug D06BAC
8-bromo-4,9-dihydro-3h-beta-carboline Small molecular drug D0G2EF
8-methoxy-2,3,4,9-tetrahydro-1h-beta-carboline Small molecular drug D0Q3VI
8-methoxy-4,9-dihydro-3h-beta-carboline Small molecular drug D0Y1GL
8-[(3-trifluoromethyl)Benzyloxy]Caffeine Small molecular drug D02FJX
9-(3-aminopropoxy)-7h-furo[3,2-g]Chromen-7-one Small molecular drug D0U9VX
9-methyl-2,3,4,9-tetrahydro-1h-beta-carboline Small molecular drug D0D2YR
Beta-methoxyamphetamine Small molecular drug D0R7ZC
Bicifadine Small molecular drug DB04889
C-(1h-indol-3-yl)-methylamine Small molecular drug D05FMZ
Cgs-19281a Small molecular drug D0D1PE
Cis-(+/-)-2-fluoro-1,2-diphenylcyclopropylamine Small molecular drug D0H1VT
Cis-2-phenylcyclopropylamine Small molecular drug D0X8RN
Clorgiline Small molecular drug DB04017
Decyl(Dimethyl)Phosphine Oxide Small molecular drug D0B0JK
Decyl(Dimethyl)Phosphine Oxide Small molecular drug DB07641
Ephedra Sinica Root Small molecular drug DB01363
Ethyl 4-(2-oxo-2h-chromene-3-carboxamido)Benzoate Small molecular drug D05HJT
Flavin-adenine Dinucleotide Small molecular drug D00IMW
Hydrazinecarboxamide Small molecular drug D0A4IY
Iproniazide Small molecular drug D08CNS
Mmda Small molecular drug D0I4ME
N'-(2-phenylallyl)Hydrazine Hydrochloride Small molecular drug D02PSR
N-((1h-indol-2-yl)Methyl)(Phenyl)Methanamine Small molecular drug D08QZP
N-((1h-indol-2-yl)Methyl)-2-phenylethanamine Small molecular drug D0Y0LQ
N-(1-methyl-1h-indol-2-ylmethyl)-n-phenylamine Small molecular drug D0KB2R
N-(1h-indol-2-ylmethyl)-n-(4-phenylbutyl)Amine Small molecular drug D08PEW
N-(1h-indol-2-ylmethyl)-n-methyl-n-phenylamine Small molecular drug D00KDZ
N-(1h-indol-2-ylmethyl)-n-phenylamine Small molecular drug D01PES
N-(2-benzyl),N-(1-methylpyrrol-2-ylmethyl)Amine Small molecular drug D0C9RO
N-(2-methyl-1h-indol-5-yl)Cyclohexanecarboxamide Small molecular drug D05WQN
N-(2-phenylethyl),N-(Pyrrol-2-ylmethyl)Amine Small molecular drug D0N8UE
N-(2-phenylethyl)-1h-indole-2-carboxamide Small molecular drug D0YO7C
N-(3-phenylpropyl)-1h-indole-2-carboxamide Small molecular drug D07LCU
N-(3-phenylpropyl)-1h-pyrrole-2-carboxamide Small molecular drug D0Y4JQ
N-(4-ethylphenyl)-2-oxo-2h-chromene-3-carboxamide Small molecular drug D0B1WD
N-(4-phenylbutyl)-1h-indole-2-carboxamide Small molecular drug D08HNJ
N-(4-phenylbutyl)-1h-pyrrole-2-carboxamide Small molecular drug D0P3DV
N-(Benzyl),N-(Pyrrol-2-ylmethyl)Amine Small molecular drug D0O2UK
N-(Propargyl),N-(Pyrrol-2-ylmethyl)Amine Small molecular drug D0G4BG
N-2-phenylethyl-1h-pyrrole-2-carboxamide Small molecular drug D0SN3L
N-benzyl,N-methyl-1h-indole-2-carboxamide Small molecular drug D0V0TN
N-benzyl,N-methyl-1h-pyrrole-2-carboxamide Small molecular drug D0C8RD
N-benzyl-(6-butoxy-2-naphthyl)-2-aminopropane Small molecular drug D02AQG
N-benzyl-(6-methoxy-2-naphthyl)-2-aminopropane Small molecular drug D0M0HM
N-benzyl-1h-indole-2-carboxamide Small molecular drug D0Z5YO
N-benzyl-1h-pyrrole-2-carboxamide Small molecular drug D0A4FA
N-benzyl-n-(1h-indol-2-ylmethyl)-n-methylamine Small molecular drug D05ANK
N-methyl,N-(Benzyl),N-(Pyrrol-2-ylmethyl)Amine Small molecular drug D0MO1O
N-methyl,N-(Propargyl),N-(Pyrrol-2-ylmethyl)Amine Small molecular drug D03KDD
N-methyl,N-phenyl-1h-indole-2-carboxamide Small molecular drug D0F7JK
N-methyl-n-(Prop-2-ynyl)-1h-pyrrole-2-carboxamide Small molecular drug D07ULQ
N-phenyl-1-methyl-1h-indole-2-carboxamide Small molecular drug D05OXR
N-phenyl-1h-indole-2-carboxamide Small molecular drug D0K9UN
N-phenyl-1h-pyrrole-2-carboxamide Small molecular drug D0KU2D
N-propargyl-1h-pyrrole-2-carboxamide Small molecular drug D0H5MV
N2-[4-(Benzyloxy)Benzyl]Glycinamide Small molecular drug D0T6XC
N2-{4-[(3-fluorobenzyl)Oxy]Benzyl}Glycinamide Small molecular drug D02QBV
N2-{4-[(4-chlorobenzyl)Oxy]Benzyl}Glycinamide Small molecular drug D03XKJ
Nsc-656158 Small molecular drug D0B4CA
Phenyl 4-(4,5-dihydro-1h-imidazol-2-yl)Benzoate Small molecular drug D08SRB
Pnu-22394 Small molecular drug D04QRS
Rauwolfia Serpentina Root Small molecular drug DB09363
Toloxatone Small molecular drug D0V3NT
Toloxatone Small molecular drug DB09245
Tracizoline Small molecular drug D09BIV
Trans-(+/-)-2-fluoro-1,2-diphenylcyclopropylamine Small molecular drug D07WFU
Trans-2-(4-chlorophenyl)-2-fluorocyclopropanamine Small molecular drug D03LGV
Trans-2-fluoro-2-(4-fluorophenyl)Cyclopropanamine Small molecular drug D08PHY
Trans-2-fluoro-2-p-tolylcyclopropanamine Small molecular drug D0F2DC
Trans-2-fluoro-2-phenylcyclopropylamin"] Small molecular drug D09HBX
Tryptoline Small molecular drug D03LPH
(R)-indan-1-yl-methyl-prop-2-ynyl-amine . D0S7FP
Fa-70 . D01UPT
Pirlindole . DB09244
Posizolid . DB04850
Patented
Click To Hide/Show 39 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Cyclic Peptide Derivative 1 Peptide D04OEV
Harmine Small molecular drug D00OWF
Heteroaryl-cyclopropylamine Derivative 1 Small molecular drug D07NTA
N-(2-phenylcyclopropyl) Amino Acid Derivative 3 Small molecular drug D08IOP
Pmid25399762-compound-figure2-artoxanthochromane Small molecular drug D03QMA
Pmid25399762-compound-figure3-aspeverin Small molecular drug D08HOV
Pmid29324067-compound-25 Small molecular drug D0AH9P
Pmid29757691-compound-4 Small molecular drug D0AA7U
Schiff Base Compound 1 Small molecular drug D05RJG
Secondary And Tertiary (Hetero)Arylamide Derivative 2 Small molecular drug D01OGR
Tacrine-coumarin Hybrid Derivative 1 Small molecular drug D0T9JB
Tarnylcypromine Derivative 2 Small molecular drug D04OHC
Tarnylcypromine Derivative 3 Small molecular drug D0O7IH
Tetra-hydro-isoquinoline Derivative 1 Small molecular drug D04AXC
Tetra-hydro-isoquinoline Derivative 2 Small molecular drug D0NB7Z
Tetra-hydro-isoquinoline Derivative 3 Small molecular drug D02EME
Tetra-hydro-isoquinoline Derivative 4 Small molecular drug D0R6RT
Aphanamgrandiola . D0XY6I
Gypensapogenina . D03YOU
Gypensapogeninb . D0R2YC
Houttuynoida . D0P1PC
Incarviatonea . D0LZ2M
Kadcoccitonea . D0G3TH
Myriberinea . D0I9CK
Phyllanthoida . D07MEE
Pmid25399762-compound-figure1-aphanamixoid A . D0TX9E
Pmid25399762-compound-figure1-chukrasone A . D0K3UV
Pmid25399762-compound-figure1-chukrasone B . D0Y9VB
Pmid25399762-compound-figure1-eryngiolide A . D0N1CG
Pmid25399762-compound-figure1-neonectrolide A . D0V6TF
Pmid25399762-compound-figure1-sarcaboside A . D05GWJ
Pmid25399762-compound-figure1-sarcaboside B . D05MYL
Pmid25399762-compound-figure2-spirooliganone B . D0I5DV
Pmid25399762-compound-figure3-fluevirosine A . D0KW7O
Pmid25399762-compound-figure3-lycojaponicumin A . D0M0EP
Pmid25399762-compound-figure3-lycojaponicumin B . D0E7OQ
Pmid25399762-compound-figure3-lycojaponicumin C . D0H7HH
Pmid25399762-compound-table 5-8 . D03EHC
Pmid25399762-compound-table 5-o-methyl-m30 . D03VGN
Discontinued
Click To Hide/Show 10 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
4-methoxyamphetamine Small molecular drug DB01472
As602868 Small molecular drug D01OLO
Befloxatone Small molecular drug D05WEP
Bifemelane Small molecular drug D02CGY
Brofaromine Small molecular drug D0IZ1D
Bw-1370u87 Small molecular drug D0E8UJ
Cs-722 Small molecular drug D0H9DE
Esuprone Small molecular drug D0ZM5W
Rs-8359 Small molecular drug D06QOJ
E-2011 . D0G9AP

References

1 Tranylcypromine specificity for monoamine oxidase is limited by promiscuous protein labelling and lysosomal trapping. RSC Chem Biol. 2020 Aug 12;1(4):209-213. doi: 10.1039/d0cb00048e. eCollection 2020 Oct 1.
Mass spectrometry data entry: PXD018580
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 Discovery of Potent and Selective Inhibitors against Protein-Derived Electrophilic Cofactors. J Am Chem Soc. 2022 Mar 30;144(12):5377-5388. doi: 10.1021/jacs.1c12748. Epub 2022 Mar 2.
4 Activity-Based Hydrazine Probes for Protein Profiling of Electrophilic Functionality in Therapeutic Targets. ACS Cent Sci. 2021 Sep 22;7(9):1524-1534. doi: 10.1021/acscentsci.1c00616. Epub 2021 Aug 19.
5 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
6 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.
7 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
8 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840