Details of the Target

General Information of Target

Target ID LDTP02365
Target Name U2 small nuclear ribonucleoprotein A' (SNRPA1)
Gene Name SNRPA1
Gene ID 6627
Synonyms
U2 small nuclear ribonucleoprotein A'; U2 snRNP A'
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGF
PLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSI
LRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKT
FNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTD
DGEEEMEEDTVTNGS
Target Bioclass
Other
Family
U2 small nuclear ribonucleoprotein A family
Subcellular location
Nucleus
Function Involved in pre-mRNA splicing as component of the spliceosome . Associated with sn-RNP U2, where it contributes to the binding of stem loop IV of U2 snRNA.
Uniprot ID
P09661
Ensemble ID
ENST00000254193.11
HGNC ID
HGNC:11152

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 24 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		14.08  LDD0402  [1]
TH211
 Probe Info  		Y117(20.00)  LDD0260  [2]
C-Sul
 Probe Info  		2.71  LDD0066  [3]
STPyne
 Probe Info  		K172(4.39); K179(10.00); K191(0.94); K193(1.72)  LDD0277  [4]
AZ-9
 Probe Info  		E218(10.00)  LDD2208  [5]
ONAyne
 Probe Info  		N.A.  LDD0273  [4]
THZ1-DTB
 Probe Info  		C89(1.03)  LDD0460  [6]
MCL-4
 Probe Info  		2.20  LDD0049  [7]
HPAP
 Probe Info  		3.17  LDD0063  [8]
HHS-465
 Probe Info  		Y117(6.01)  LDD2237  [9]
DBIA
 Probe Info  		C89(0.66)  LDD1508  [10]
ATP probe
 Probe Info  		K172(0.00); K149(0.00); K221(0.00); K193(0.00)  LDD0199  [11]
ATP probe
 Probe Info  		K179(0.00); K67(0.00)  LDD0035  [12]
IPM
 Probe Info  		N.A.  LDD0025  [13]
JW-RF-010
 Probe Info  		N.A.  LDD0026  [13]
TFBX
 Probe Info  		N.A.  LDD0027  [13]
IA-alkyne
 Probe Info  		N.A.  LDD0149  [14]
NHS
 Probe Info  		K179(0.00); K193(0.00); K191(0.00); K221(0.00)  LDD0010  [15]
SF
 Probe Info  		N.A.  LDD0028  [16]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [17]
1c-yne
 Probe Info  		K3(0.00); K205(0.00); K179(0.00)  LDD0228  [18]
1d-yne
 Probe Info  		N.A.  LDD0357  [18]
MPP-AC
 Probe Info  		N.A.  LDD0428  [19]
NAIA_5
 Probe Info  		C89(0.00); C77(0.00)  LDD2223  [20]
PAL-AfBPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C056
 Probe Info  		19.84  LDD1753  [21]
C285
 Probe Info  		19.43  LDD1955  [21]
VE-P
 Probe Info  		N.A.  LDD0396  [22]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0215  AC10 HEK-293T C89(0.66)  LDD1508  [10]
 LDCM0237  AC12 HEK-293T C89(1.09)  LDD1510  [10]
 LDCM0277  AC18 HEK-293T C89(0.70)  LDD1516  [10]
 LDCM0279  AC2 HEK-293T C89(0.73)  LDD1518  [10]
 LDCM0280  AC20 HEK-293T C89(1.14)  LDD1519  [10]
 LDCM0281  AC21 HEK-293T C89(1.00)  LDD1520  [10]
 LDCM0286  AC26 HEK-293T C89(0.72)  LDD1525  [10]
 LDCM0288  AC28 HEK-293T C89(0.84)  LDD1527  [10]
 LDCM0289  AC29 HEK-293T C89(0.96)  LDD1528  [10]
 LDCM0295  AC34 HEK-293T C89(0.93)  LDD1534  [10]
 LDCM0297  AC36 HEK-293T C89(1.02)  LDD1536  [10]
 LDCM0298  AC37 HEK-293T C89(1.17)  LDD1537  [10]
 LDCM0301  AC4 HEK-293T C89(0.93)  LDD1540  [10]
 LDCM0304  AC42 HEK-293T C89(0.77)  LDD1543  [10]
 LDCM0306  AC44 HEK-293T C89(1.31)  LDD1545  [10]
 LDCM0307  AC45 HEK-293T C89(0.96)  LDD1546  [10]
 LDCM0312  AC5 HEK-293T C89(1.05)  LDD1551  [10]
 LDCM0313  AC50 HEK-293T C89(1.05)  LDD1552  [10]
 LDCM0315  AC52 HEK-293T C89(1.03)  LDD1554  [10]
 LDCM0316  AC53 HEK-293T C89(1.02)  LDD1555  [10]
 LDCM0321  AC58 HEK-293T C89(0.68)  LDD1560  [10]
 LDCM0324  AC60 HEK-293T C89(0.91)  LDD1563  [10]
 LDCM0325  AC61 HEK-293T C89(0.89)  LDD1564  [10]
 LDCM0248  AKOS034007472 HEK-293T C89(1.06)  LDD1511  [10]
 LDCM0156  Aniline NCI-H1299 11.59  LDD0403  [1]
 LDCM0405  CL18 HEK-293T C89(1.10)  LDD1609  [10]
 LDCM0408  CL20 HEK-293T C89(1.00)  LDD1612  [10]
 LDCM0409  CL21 HEK-293T C89(0.85)  LDD1613  [10]
 LDCM0419  CL30 HEK-293T C89(0.73)  LDD1623  [10]
 LDCM0421  CL32 HEK-293T C89(1.15)  LDD1625  [10]
 LDCM0422  CL33 HEK-293T C89(0.89)  LDD1626  [10]
 LDCM0432  CL42 HEK-293T C89(0.66)  LDD1636  [10]
 LDCM0434  CL44 HEK-293T C89(1.11)  LDD1638  [10]
 LDCM0435  CL45 HEK-293T C89(0.95)  LDD1639  [10]
 LDCM0445  CL54 HEK-293T C89(0.29)  LDD1648  [10]
 LDCM0447  CL56 HEK-293T C89(1.23)  LDD1650  [10]
 LDCM0448  CL57 HEK-293T C89(0.84)  LDD1651  [10]
 LDCM0451  CL6 HEK-293T C89(0.68)  LDD1654  [10]
 LDCM0458  CL66 HEK-293T C89(0.88)  LDD1661  [10]
 LDCM0460  CL68 HEK-293T C89(1.24)  LDD1663  [10]
 LDCM0461  CL69 HEK-293T C89(0.99)  LDD1664  [10]
 LDCM0471  CL78 HEK-293T C89(0.67)  LDD1674  [10]
 LDCM0473  CL8 HEK-293T C89(0.76)  LDD1676  [10]
 LDCM0474  CL80 HEK-293T C89(0.93)  LDD1677  [10]
 LDCM0475  CL81 HEK-293T C89(0.99)  LDD1678  [10]
 LDCM0484  CL9 HEK-293T C89(0.96)  LDD1687  [10]
 LDCM0485  CL90 HEK-293T C89(0.50)  LDD1688  [10]
 LDCM0487  CL92 HEK-293T C89(0.87)  LDD1690  [10]
 LDCM0488  CL93 HEK-293T C89(0.93)  LDD1691  [10]
 LDCM0022  KB02 ICC108 C89(1.05)  LDD2381  [23]
 LDCM0023  KB03 ICC108 C89(1.20)  LDD2798  [23]
 LDCM0024  KB05 ICC108 C89(1.20)  LDD3215  [23]
 LDCM0006  Micheliolide M9-ENL1 2.20  LDD0049  [7]
 LDCM0014  Panhematin K562 3.17  LDD0063  [8]
 LDCM0021  THZ1 HeLa S3 C89(1.03)  LDD0460  [6]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Other
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Pre-mRNA-splicing factor SYF1 (XAB2) Crooked-neck family Q9HCS7
U1 small nuclear ribonucleoprotein A (SNRPA) RRM U1 A/B'' family P09012
U2 small nuclear ribonucleoprotein B'' (SNRPB2) RRM U1 A/B'' family P08579
Splicing factor 3A subunit 2 (SF3A2) SF3A2 family Q15428
PRKCA-binding protein (PICK1) . Q9NRD5

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
3 Low-Toxicity Sulfonium-Based Probes for Cysteine-Specific Profiling in Live Cells. Anal Chem. 2022 Mar 15;94(10):4366-4372. doi: 10.1021/acs.analchem.1c05129. Epub 2022 Mar 4.
4 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
5 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
6 A Chemoproteomic Strategy for Direct and Proteome-Wide Covalent Inhibitor Target-Site Identification. J Am Chem Soc. 2019 Jan 9;141(1):191-203. doi: 10.1021/jacs.8b07911. Epub 2018 Dec 20.
7 Comprehensive Structure-Activity Profiling of Micheliolide and its Targeted Proteome in Leukemia Cells via Probe-Guided Late-Stage C-H Functionalization. ACS Cent Sci. 2021 May 26;7(5):841-857. doi: 10.1021/acscentsci.0c01624. Epub 2021 Apr 28.
Mass spectrometry data entry: PXD024455
8 A Chemical Proteomic Map of Heme-Protein Interactions. J Am Chem Soc. 2022 Aug 24;144(33):15013-15019. doi: 10.1021/jacs.2c06104. Epub 2022 Aug 12.
Mass spectrometry data entry: PXD034651
9 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
10 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
11 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
12 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096
13 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
14 Sequence-Based Prediction of Cysteine Reactivity Using Machine Learning. Biochemistry. 2018 Jan 30;57(4):451-460. doi: 10.1021/acs.biochem.7b00897. Epub 2017 Oct 26.
15 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
16 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
17 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
18 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
19 Differently Tagged Probes for Protein Profiling of Mitochondria. Chembiochem. 2019 May 2;20(9):1155-1160. doi: 10.1002/cbic.201800735. Epub 2019 Mar 26.
20 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
21 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
22 Pharmacological Targeting of Vacuolar H(+)-ATPase via Subunit V1G Combats Multidrug-Resistant Cancer. Cell Chem Biol. 2020 Nov 19;27(11):1359-1370.e8. doi: 10.1016/j.chembiol.2020.06.011. Epub 2020 Jul 9.
23 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840