Details of the Target

General Information of Target

Target ID	LDTP01513
Target Name	NADH dehydrogenase 1 alpha subcomplex subunit 3 (NDUFA3)
Gene Name	NDUFA3
Gene ID	4696
Synonyms	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3; Complex I-B9; CI-B9; NADH-ubiquinone oxidoreductase B9 subunit
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDD GNMPDVPSHPQDPQGPSLEWLKKL
Target Bioclass	Enzyme
Family	Complex I NDUFA3 subunit family
Subcellular location	Mitochondrion inner membrane
Function	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Uniprot ID	O95167
Ensemble ID	ENST00000419113.5
HGNC ID	HGNC:7686
ChEMBL ID	CHEMBL2363065

Probe(s) Labeling This Target

ABPP Probe

Click To Hide/Show 2 Probe Related to This Target

Probe name		Structure	Binding Site(Ratio)	Interaction ID	Ref
TH211 Probe Info			Y41(6.47)	LDD0260	[1]
m-APA Probe Info			N.A.	LDD2231	[2]

PAL-AfBPP Probe

Click To Hide/Show 11 Probe Related to This Target

Probe name	Binding Site(Ratio)	Interaction ID	Ref
C055 Probe Info	18.25	LDD1752	[3]
C056 Probe Info	38.05	LDD1753	[3]
C112 Probe Info	19.84	LDD1799	[3]
C194 Probe Info	8.82	LDD1870	[3]
C196 Probe Info	16.56	LDD1872	[3]
C198 Probe Info	11.79	LDD1874	[3]
C238 Probe Info	11.24	LDD1911	[3]
C289 Probe Info	54.57	LDD1959	[3]
C388 Probe Info	81.01	LDD2047	[3]
FFF probe11 Probe Info	20.00	LDD0471	[4]
FFF probe2 Probe Info	20.00	LDD0463	[4]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme

Click To Hide/Show 3 Protein(s) Interacting with This Target

Protein name	Family	Uniprot ID
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (EBP)	EBP family	Q15125
Vesicle transport protein GOT1A (GOLT1A)	GOT1 family	Q6ZVE7
TLC domain-containing protein 4 (TLCD4)	TLCD4 family	Q96MV1

Transporter and channel

Click To Hide/Show 8 Protein(s) Interacting with This Target

Protein name	Family	Uniprot ID
Large neutral amino acids transporter small subunit 2 (SLC7A8)	L-type amino acid transporter (LAT) (TC 2.A.3.8) family	Q9UHI5
Transmembrane 4 L6 family member 19 (TM4SF19)	L6 tetraspanin family	Q96DZ7
ER membrane protein complex subunit 5 (MMGT1)	Membrane magnesium transporter (TC 1.A.67) family	Q8N4V1
Transmembrane protein 14B (TMEM14B)	TMEM14 family	Q9NUH8
Transmembrane protein 205 (TMEM205)	TMEM205 family	Q6UW68
Transmembrane protein 242 (TMEM242)	TMEM242 family	Q9NWH2
Thioredoxin-related transmembrane protein 2 (TMX2)	.	Q9Y320
Transmembrane protein 101 (TMEM101)	.	Q96IK0

Other

Click To Hide/Show 2 Protein(s) Interacting with This Target

Protein name				Family	Uniprot ID
Ergosterol biosynthetic protein 28 homolog (ERG28)				ERG28 family	Q9UKR5
Leptin receptor overlapping transcript-like 1 (LEPROTL1)				OB-RGRP/VPS55 family	O95214

The Drug(s) Related To This Target

Approved

Click To Hide/Show 1 Drug(s) Interacting with This Target

Drug Name				Drug Type	External ID
Nadh				Small molecular drug	DB00157

References

1	Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
2	Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print. Mass spectrometry data entry: PXD042377
3	Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26. Mass spectrometry data entry: PXD041587
4	Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.