Details of the Target
General Information of Target
| Target ID | LDTP14610 | |||||
|---|---|---|---|---|---|---|
| Target Name | Golgi pH regulator B (GPR89B) | |||||
| Gene Name | GPR89B | |||||
| Gene ID | 51463 | |||||
| Synonyms |
GPHRB; GPR89C; Golgi pH regulator B; Protein GPR89B |
|||||
| 3D Structure | ||||||
| Sequence |
GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVKVAWKADGSPVNTGVETTTPSK
QSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPAECS |
|||||
| Target Bioclass |
GPCR
|
|||||
| Family |
Golgi pH regulator (TC 1.A.38) family
|
|||||
| Subcellular location |
Golgi apparatus membrane
|
|||||
| Function |
Voltage dependent anion channel required for acidification and functions of the Golgi apparatus that may function in counter-ion conductance. Plays a role in lymphocyte development, probably by acting as a RABL3 effector in hematopoietic cells.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
 |
11.60 | LDD0402 | [1] | |
|
AOyne Probe Info |
 |
14.40 | LDD0443 | [2] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C056 Probe Info |
 |
16.11 | LDD1753 | [3] | |
|
C177 Probe Info |
 |
8.06 | LDD1856 | [3] | |
|
C201 Probe Info |
 |
27.28 | LDD1877 | [3] | |
|
C343 Probe Info |
 |
11.63 | LDD2005 | [3] | |
|
FFF probe11 Probe Info |
 |
18.41 | LDD0471 | [4] | |
|
FFF probe13 Probe Info |
 |
20.00 | LDD0475 | [4] | |
|
FFF probe14 Probe Info |
 |
20.00 | LDD0477 | [4] | |
|
FFF probe2 Probe Info |
 |
20.00 | LDD0463 | [4] | |
|
Alk-rapa Probe Info |
 |
3.16 | LDD0213 | [5] | |
|
OEA-DA Probe Info |
 |
10.48 | LDD0046 | [6] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References