Details of the Target

General Information of Target

Target ID LDTP13273
Target Name Ubiquilin-2 (UBQLN2)
Gene Name UBQLN2
Gene ID 29978
Synonyms
N4BP4; PLIC2; Ubiquilin-2; Chap1; DSK2 homolog; Protein linking IAP with cytoskeleton 2; PLIC-2; hPLIC-2; Ubiquitin-like product Chap1/Dsk2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MKKSYSGGTRTSSGRLRRLGDSSGPALKRSFEVEEVETPNSTPPRRVQTPLLRATVASST
QKFQDLGVKNSEPSARHVDSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVE
NAGAIGPSRFGLKRAEVLGHKTPEPAPRRTEITIVKPQESAHRRMEPPASKVPEVPTAPA
TDAAPKRVEIQMPKPAEAPTAPSPAQTLENSEPAPVSQLQSRLEPKPQPPVAEATPRSQE
ATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFN
IMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIPKTIEIKSITHDIEEKGVRMKLTV
IDTPGFGDHINNENCWQPIMKFINDQYEKYLQEEVNINRKKRIPDTRVHCCLYFIPATGH
SLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVHFKQRITADLLSNGIDVYPQKEFDE
DSEDRLVNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFAYLRDLL
IRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEKEPEAPEM
Target Bioclass
Other
Subcellular location
Cytoplasm
Function
Plays an important role in the regulation of different protein degradation mechanisms and pathways including ubiquitin-proteasome system (UPS), autophagy and the endoplasmic reticulum-associated protein degradation (ERAD) pathway. Mediates the proteasomal targeting of misfolded or accumulated proteins for degradation by binding (via UBA domain) to their polyubiquitin chains and by interacting (via ubiquitin-like domain) with the subunits of the proteasome. Plays a role in the ERAD pathway via its interaction with ER-localized proteins FAF2/UBXD8 and HERPUD1 and may form a link between the polyubiquitinated ERAD substrates and the proteasome. Involved in the regulation of macroautophagy and autophagosome formation; required for maturation of autophagy-related protein LC3 from the cytosolic form LC3-I to the membrane-bound form LC3-II and may assist in the maturation of autophagosomes to autolysosomes by mediating autophagosome-lysosome fusion. Negatively regulates the endocytosis of GPCR receptors: AVPR2 and ADRB2, by specifically reducing the rate at which receptor-arrestin complexes concentrate in clathrin-coated pits (CCPs).
Uniprot ID
Q9UHD9
Ensemble ID
ENST00000338222.7
HGNC ID
HGNC:12509

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TH211
 Probe Info  		Y272(18.47); Y265(11.47)  LDD0257  [1]
TH216
 Probe Info  		Y265(12.53)  LDD0259  [1]
AZ-9
 Probe Info  		E246(10.00)  LDD2208  [2]
ONAyne
 Probe Info  		N.A.  LDD0273  [3]
HHS-465
 Probe Info  		Y265(10.00)  LDD2237  [4]
5E-2FA
 Probe Info  		N.A.  LDD2235  [5]
m-APA
 Probe Info  		H223(0.00); H90(0.00)  LDD2231  [5]
Acrolein
 Probe Info  		N.A.  LDD0217  [6]
PAL-AfBPP Probe
Click To Hide/Show 11 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C022
 Probe Info  		6.92  LDD1728  [7]
C238
 Probe Info  		11.55  LDD1911  [7]
C264
 Probe Info  		17.75  LDD1935  [7]
C265
 Probe Info  		12.91  LDD1936  [7]
C289
 Probe Info  		25.28  LDD1959  [7]
C390
 Probe Info  		25.46  LDD2049  [7]
C391
 Probe Info  		13.74  LDD2050  [7]
FFF probe11
 Probe Info  		20.00  LDD0471  [8]
FFF probe13
 Probe Info  		20.00  LDD0475  [8]
FFF probe14
 Probe Info  		20.00  LDD0477  [8]
FFF probe3
 Probe Info  		20.00  LDD0465  [8]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0109  NEM HeLa N.A.  LDD0223  [6]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 51 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Anterior gradient protein 2 homolog (AGR2) AGR family O95994
Anterior gradient protein 3 (AGR3) AGR family Q8TD06
Alpha-S1-casein (CSN1S1) Alpha-casein family P47710
Aspartoacylase (ASPA) AspA/AstE family P45381
Beta-casein (CSN2) Beta-casein family P05814
Prostaglandin-H2 D-isomerase (PTGDS) Lipocalin family P41222
Ethanolamine kinase 1 (ETNK1) Choline/ethanolamine kinase family Q9HBU6
Colipase-like protein 2 (CLPSL2) Colipase family Q6UWE3
Extracellular superoxide dismutase [Cu-Zn] (SOD3) Cu-Zn superoxide dismutase family P08294
Peptidyl-prolyl cis-trans isomerase C (PPIC) Cyclophilin-type PPIase family P45877
Peptidyl-prolyl cis-trans isomerase B (PPIB) Cyclophilin-type PPIase family P23284
Peptidyl-prolyl cis-trans isomerase H (PPIH) Cyclophilin-type PPIase family O43447
Desumoylating isopeptidase 1 (DESI1) DeSI family Q6ICB0
DNA polymerase epsilon subunit 2 (POLE2) DNA polymerase epsilon subunit B family P56282
CTD nuclear envelope phosphatase 1 (CTDNEP1) Dullard family O95476
Peptidyl-prolyl cis-trans isomerase FKBP2 (FKBP2) FKBP-type PPIase family P26885
Glutaminyl-peptide cyclotransferase (QPCT) Glutaminyl-peptide cyclotransferase family Q16769
Glutathione peroxidase 7 (GPX7) Glutathione peroxidase family Q96SL4
Beta-hexosaminidase subunit beta (HEXB) Glycosyl hydrolase 20 family P07686
Tissue alpha-L-fucosidase (FUCA1) Glycosyl hydrolase 29 family P04066
Procollagen galactosyltransferase 2 (COLGALT2) Glycosyltransferase 25 family Q8IYK4
Phospholipase A and acyltransferase 2 (PLAAT2) H-rev107 family Q9NWW9
Phospholipase A and acyltransferase 3 (PLAAT3) H-rev107 family P53816
Multiple inositol polyphosphate phosphatase 1 (MINPP1) Histidine acid phosphatase family Q9UNW1
Inositol-trisphosphate 3-kinase B (ITPKB) Inositol phosphokinase (IPK) family P27987
Kappa-casein (CSN3) Kappa-casein family P07498
NADPH-dependent diflavin oxidoreductase 1 (NDOR1) NADPH-dependent diflavin oxidoreductase NDOR1 family; Flavodoxin family; Flavoprotein pyridine nucleotide cytochrome reductase family Q9UHB4
Nucleoside diphosphate kinase 3 (NME3) NDK family Q13232
ATP-dependent (S)-NAD(P)H-hydrate dehydratase (NAXD) NnrD/CARKD family Q8IW45
Calpain-15 (CAPN15) Peptidase C2 family O75808
Inactive Ufm1-specific protease 1 (UFSP1) Peptidase C78 family Q6NVU6
Coagulation factor X (F10) Peptidase S1 family P00742
26S proteasome non-ATPase regulatory subunit 2 (PSMD2) Proteasome subunit S2 family Q13200
Endoplasmic reticulum resident protein 27 (ERP27) Protein disulfide isomerase family Q96DN0
Thioredoxin domain-containing protein 5 (TXNDC5) Protein disulfide isomerase family Q8NBS9
MTRF1L release factor glutamine methyltransferase (HEMK1) Protein N5-glutamine methyltransferase family Q9Y5R4
Dual specificity protein phosphatase 21 (DUSP21) Protein-tyrosine phosphatase family Q9H596
Cytosolic 5'-nucleotidase 3A (NT5C3A) Pyrimidine 5'-nucleotidase family Q9H0P0
Very-long-chain 3-oxoacyl-CoA reductase (HSD17B12) Short-chain dehydrogenases/reductases (SDR) family Q53GQ0
Terminal nucleotidyltransferase 5B (TENT5B) TENT family Q96A09
TNF receptor-associated factor 4 (TRAF4) TNF receptor-associated factor family Q9BUZ4
E3 ubiquitin-protein ligase TRIM32 (TRIM32) TRIM/RBCC family Q13049
Ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1) Ubiquitin-conjugating enzyme family Q13404
A disintegrin and metalloproteinase with thrombospondin motifs 3 (ADAMTS3) . O15072
E3 ubiquitin-protein ligase RNF128 (RNF128) . Q8TEB7
E3 ubiquitin-protein ligase RNF4 (RNF4) . P78317
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (PIN1) . Q13526
Phosphoinositide-3-kinase-interacting protein 1 (PIK3IP1) . Q96FE7
RING finger protein 208 (RNF208) . Q9H0X6
Sulfite oxidase, mitochondrial (SUOX) . P51687
Thioredoxin domain-containing protein 12 (TXNDC12) . O95881
Transporter and channel
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Metal transporter CNNM3 (CNNM3) ACDP family Q8NE01
Defensin-6 (DEFA6) Alpha-defensin family Q01524
Neutrophil defensin 1 (DEFA1; DEFA1B) Alpha-defensin family P59665
Arrestin domain-containing protein 3 (ARRDC3) Arrestin family Q96B67
Bcl-2-like protein 11 (BCL2L11) Bcl-2 family O43521
Huntingtin (HTT) Huntingtin family P42858
Monocarboxylate transporter 4 (SLC16A3) Monocarboxylate porter (TC 2.A.1.13) family O15427
Metaxin-2 (MTX2) Metaxin family O75431
Nucleoporin p58/p45 (NUP58) NUP58 family Q9BVL2
Small integral membrane protein 2 (SMIM2) . Q9BVW6
Vitronectin (VTN) . P04004
Transcription factor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Transcriptional repressor RHIT (ZNF205) Krueppel C2H2-type zinc-finger protein family O95201
Achaete-scute homolog 1 (ASCL1) . P50553
Homeobox protein VENTX (VENTX) . O95231
GPCR
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Neuropeptides B/W receptor type 1 (NPBWR1) G-protein coupled receptor 1 family P48145
Olfactory receptor 7D4 (OR7D4) G-protein coupled receptor 1 family Q8NG98
Probable G-protein coupled receptor 162 (GPR162) G-protein coupled receptor 1 family Q16538
Melanopsin (OPN4) G-protein coupled receptor 1 family Q9UHM6
Frizzled-7 (FZD7) G-protein coupled receptor Fz/Smo family O75084
Immunoglobulin
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) CEA family P40199
Intercellular adhesion molecule 1 (ICAM1) ICAM family P05362
Zinc-alpha-2-glycoprotein (AZGP1) MHC class I family P25311
Immunoglobulin lambda-like polypeptide 1 (IGLL1) . P15814
Leukocyte-associated immunoglobulin-like receptor 2 (LAIR2) . Q6ISS4
Cytokine and receptor
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Interferon alpha-1/13 (IFNA1; IFNA13) Alpha/beta interferon family P01562
Interleukin-11 (IL11) IL-6 superfamily P20809
C-C motif chemokine 16 (CCL16) Intercrine beta (chemokine CC) family O15467
C-C motif chemokine 3 (CCL3) Intercrine beta (chemokine CC) family P10147
C-C motif chemokine 7 (CCL7) Intercrine beta (chemokine CC) family P80098
Oncostatin-M-specific receptor subunit beta (OSMR) Type I cytokine receptor family Q99650
Other
Click To Hide/Show 131 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Neuroendocrine protein 7B2 (SCG5) 7B2 family P05408
Proteasomal ubiquitin receptor ADRM1 (ADRM1) ADRM1 family Q16186
Ameloblastin (AMBN) Ameloblastin family Q9NP70
Apolipoprotein C-IV (APOC4) Apolipoprotein C4 family P55056
Ataxin-10 (ATXN10) Ataxin-10 family Q9UBB4
Augurin (ECRG4) Augurin family Q9H1Z8
Beta-defensin 115 (DEFB115) Beta-defensin family Q30KQ5
BPI fold-containing family A member 1 (BPIFA1) Plunc family Q9NP55
Complement component C8 gamma chain (C8G) Lipocalin family P07360
Lipocalin-1 (LCN1) Lipocalin family P31025
Neutrophil gelatinase-associated lipocalin (LCN2) Lipocalin family P80188
Nucleolar complex protein 4 homolog (NOC4L) CBF/MAK21 family Q9BVI4
CCN family member 1 (CCN1) CCN family O00622
Porimin (TMEM123) CD164 family Q8N131
CD99 antigen-like protein 2 (CD99L2) CD99 family Q8TCZ2
Cell death-inducing p53-target protein 1 (CDIP1) CDIP1/LITAF family Q9H305
Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF) CDIP1/LITAF family Q99732
Cancer/testis antigen 1 (CTAG1A; CTAG1B) CTAG/PCC1 family P78358
Cystatin-S (CST4) Cystatin family P01036
Cystatin-SN (CST1) Cystatin family P01037
Dermokine (DMKN) Dermokine family Q6E0U4
Retrotransposon Gag-like protein 8A (RTL8A) FAM127 family Q9BWD3
Retrotransposon Gag-like protein 8B (RTL8B) FAM127 family Q17RB0
Retrotransposon Gag-like protein 8C (RTL8C) FAM127 family A6ZKI3
Protein FAM222B (FAM222B) FAM222 family Q8WU58
Pro-FMRFamide-related neuropeptide VF (NPVF) FARP (FMRFamide related peptide) family Q9HCQ7
Collagen alpha-2(IX) chain (COL9A2) Fibril-associated collagens with interrupted helices (FACIT) family Q14055
Collagen alpha-2(I) chain (COL1A2) Fibrillar collagen family P08123
EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1) Fibulin family Q12805
Galanin peptides (GAL) Galanin family P22466
Galanin-like peptide (GALP) Galanin family Q9UBC7
Cholecystokinin (CCK) Gastrin/cholecystokinin family P06307
Guanylate cyclase activator 2B (GUCA2B) Guanylin family Q16661
Guanylin (GUCA2A) Guanylin family Q02747
Heat shock 70 kDa protein 13 (HSPA13) Heat shock protein 70 family P48723
Fibroblast growth factor 17 (FGF17) Heparin-binding growth factors family O60258
Keratin, type II cytoskeletal 6A (KRT6A) Intermediate filament family P02538
Pancreatic adenocarcinoma up-regulated factor (ZG16B) Jacalin lectin family Q96DA0
Zymogen granule membrane protein 16 (ZG16) Jacalin lectin family O60844
Junctophilin-4 (JPH4) Junctophilin family Q96JJ6
Metastasis-suppressor KiSS-1 (KISS1) KISS1 family Q15726
Keratin-associated protein 12-1 (KRTAP12-1) KRTAP type 12 family P59990
Keratin-associated protein 19-3 (KRTAP19-3) KRTAP type 19 family Q7Z4W3
Keratin-associated protein 19-5 (KRTAP19-5) KRTAP type 19 family Q3LI72
Appetite-regulating hormone (GHRL) Motilin family Q9UBU3
Myeloid-derived growth factor (MYDGF) MYDGF family Q969H8
Natriuretic peptides A (NPPA) Natriuretic peptide family P01160
Epidermal growth factor-like protein 6 (EGFL6) Nephronectin family Q8IUX8
Neuritin-like protein (NRN1L) Neuritin family Q496H8
Pro-neuropeptide Y (NPY) NPY family P01303
Prostate androgen-regulated mucin-like protein 1 (PARM1) PARM family Q6UWI2
Midkine (MDK) Pleiotrophin family P21741
Modulator of apoptosis 1 (MOAP1) PNMA family Q96BY2
Paraneoplastic antigen Ma3 (PNMA3) PNMA family Q9UL41
Submaxillary gland androgen-regulated protein 3B (SMR3B) PROL1/PROL3 family P02814
Metalloproteinase inhibitor 2 (TIMP2) Protease inhibitor I35 (TIMP) family P16035
UV excision repair protein RAD23 homolog A (RAD23A) RAD23 family P54725
UV excision repair protein RAD23 homolog B (RAD23B) RAD23 family P54727
Arginine/serine-rich coiled-coil protein 2 (RSRC2) RSRC2 family Q7L4I2
Secretoglobin family 2B member 2 (SCGB2B2) Secretoglobin family Q4G0G5
Serglycin (SRGN) Serglycin family P10124
Plasminogen activator inhibitor 1 (SERPINE1) Serpin family P05121
Serpin I2 (SERPINI2) Serpin family O75830
Seizure protein 6 homolog (SEZ6) SEZ6 family Q53EL9
Pulmonary surfactant-associated protein A2 (SFTPA2) SFTPA family Q8IWL1
Small glutamine-rich tetratricopeptide repeat-containing protein alpha (SGTA) SGT family O43765
SLIT and NTRK-like protein 1 (SLITRK1) SLITRK family Q96PX8
Mitochondrial dynamics protein MIEF1 (MIEF1) SMCR7 family Q9NQG6
Small integral membrane protein 19 (SMIM19) SMIM19 family Q96E16
Signal transducing adapter molecule 2 (STAM2) STAM family O75886
Mitochondrial import inner membrane translocase subunit Tim21 (TIMM21) TIM21 family Q9BVV7
TOMM20-like protein 1 (TOMM20L) Tom20 family Q6UXN7
Polyubiquitin-B (UBB) Ubiquitin family P0CG47
Polyubiquitin-C (UBC) Ubiquitin family P0CG48
Ubiquitin-ribosomal protein eL40 fusion protein (UBA52) Ubiquitin family; Eukaryotic ribosomal protein eL40 family P62987
Ubiquitin-ribosomal protein eS31 fusion protein (RPS27A) Ubiquitin family; Eukaryotic ribosomal protein eS31 family P62979
AN1-type zinc finger protein 2A (ZFAND2A) . Q8N6M9
AN1-type zinc finger protein 2B (ZFAND2B) . Q8WV99
Antileukoproteinase (SLPI) . P03973
Brorin (VWC2) . Q2TAL6
C-type lectin domain family 11 member A (CLEC11A) . Q9Y240
Cadherin-15 (CDH15) . P55291
Cadherin-17 (CDH17) . Q12864
Cleavage stimulation factor subunit 2 (CSTF2) . P33240
Cleavage stimulation factor subunit 2 tau variant (CSTF2T) . Q9H0L4
Collagen alpha-1(VIII) chain (COL8A1) . P27658
Collagen alpha-1(X) chain (COL10A1) . Q03692
Collagen alpha-1(XVII) chain (COL17A1) . Q9UMD9
Complement C1q subcomponent subunit A (C1QA) . P02745
Complement C1q subcomponent subunit B (C1QB) . P02746
Complement C1q subcomponent subunit C (C1QC) . P02747
Complement C1q tumor necrosis factor-related protein 2 (C1QTNF2) . Q9BXJ5
Complement C1q tumor necrosis factor-related protein 4 (C1QTNF4) . Q9BXJ3
Complement C1q-like protein 4 (C1QL4) . Q86Z23
DAZ-associated protein 2 (DAZAP2) . Q15038
Endoplasmic reticulum resident protein 29 (ERP29) . P30040
Epidermal growth factor receptor substrate 15 (EPS15) . P42566
Extracellular matrix protein 1 (ECM1) . Q16610
Fibronectin type III domain-containing protein 11 (FNDC11) . Q9BVV2
Follicular dendritic cell secreted peptide (FDCSP) . Q8NFU4
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
Heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1) . P09651
Heterogeneous nuclear ribonucleoprotein U (HNRNPU) . Q00839
Insulin-like growth factor-binding protein 6 (IGFBP6) . P24592
IQ domain-containing protein F3 (IQCF3) . P0C7M6
Kelch-like protein 11 (KLHL11) . Q9NVR0
Kelch-like protein 42 (KLHL42) . Q9P2K6
Leukosialin (SPN) . P16150
LIM domain transcription factor LMO4 (LMO4) . P61968
Lymphocyte antigen 6 complex locus protein G6d (LY6G6D) . O95868
Mannose-binding protein C (MBL2) . P11226
Melanoma-associated antigen D1 (MAGED1) . Q9Y5V3
Nucleolar protein 3 (NOL3) . O60936
Odontogenesis associated phosphoprotein (ODAPH) . Q17RF5
PILR alpha-associated neural protein (PIANP) . Q8IYJ0
Pleckstrin homology domain-containing family B member 2 (PLEKHB2) . Q96CS7
Proline-rich acidic protein 1 (PRAP1) . Q96NZ9
Proline-rich protein 4 (PRR4) . Q16378
Protein WFDC10B (WFDC10B) . Q8IUB3
Psoriasis susceptibility 1 candidate gene 2 protein (PSORS1C2) . Q9UIG4
RING finger protein 11 (RNF11) . Q9Y3C5
Small integral membrane protein 11 (SMIM11) . P58511
Trefoil factor 3 (TFF3) . Q07654
Ubiquilin-1 (UBQLN1) . Q9UMX0
Ubiquilin-2 (UBQLN2) . Q9UHD9
Ubiquitin-associated domain-containing protein 1 (UBAC1) . Q9BSL1
UBX domain-containing protein 7 (UBXN7) . O94888
Uncharacterized protein C1orf94 (C1orf94) . Q6P1W5
Uncharacterized protein C6orf15 (C6orf15) . Q6UXA7
Uveal autoantigen with coiled-coil domains and ankyrin repeats (UACA) . Q9BZF9
WAP four-disulfide core domain protein 12 (WFDC12) . Q8WWY7

References

1 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
2 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
3 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
4 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
5 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
6 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
7 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
8 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.