Details of the Target
General Information of Target
| Target ID | LDTP08177 | |||||
|---|---|---|---|---|---|---|
| Target Name | Dehydrodolichyl diphosphate synthase complex subunit DHDDS (DHDDS) | |||||
| Gene Name | DHDDS | |||||
| Gene ID | 79947 | |||||
| Synonyms |
HDS; Dehydrodolichyl diphosphate synthase complex subunit DHDDS; EC 2.5.1.87; Cis-isoprenyltransferase; CIT; Cis-IPTase; Cis-prenyltransferase subunit hCIT; Epididymis tissue protein Li 189m |
|||||
| 3D Structure | ||||||
| Sequence |
MSWIKEGELSLWERFCANIIKAGPMPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAE
TLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRV LGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDP SDISESLLDKCLYTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQPVLWPEYTFWNL FEAILQFQMNHSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLH KLSARREERVQGFLQALELKRADWLARLGTASA |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
UPP synthase family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
With NUS1, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Both subunits contribute to enzymatic activity, i.e. condensation of multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precursor of dolichol phosphate which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER). Synthesizes long-chain polyprenols, mostly of C95 and C100 chain length. Regulates the glycosylation and stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C117(2.28) | LDD3333 | [1] | |
|
BTD Probe Info |
![]() |
C43(0.77) | LDD2092 | [2] | |
|
IA-alkyne Probe Info |
![]() |
C191(0.00); C16(0.00) | LDD0165 | [3] | |
|
TFBX Probe Info |
![]() |
C117(0.00); C16(0.00) | LDD0148 | [4] | |
|
Phosphinate-6 Probe Info |
![]() |
N.A. | LDD0018 | [5] | |
|
AOyne Probe Info |
![]() |
9.10 | LDD0443 | [6] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C134 Probe Info |
![]() |
22.63 | LDD1816 | [7] | |
|
C249 Probe Info |
![]() |
25.28 | LDD1922 | [7] | |
|
C287 Probe Info |
![]() |
10.48 | LDD1957 | [7] | |
|
C288 Probe Info |
![]() |
6.87 | LDD1958 | [7] | |
|
C289 Probe Info |
![]() |
41.93 | LDD1959 | [7] | |
|
C293 Probe Info |
![]() |
27.86 | LDD1963 | [7] | |
|
C296 Probe Info |
![]() |
67.65 | LDD1966 | [7] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0548 | 1-(4-(Benzo[d][1,3]dioxol-5-ylmethyl)piperazin-1-yl)-2-nitroethan-1-one | MDA-MB-231 | C43(0.76) | LDD2142 | [2] |
| LDCM0519 | 1-(6-methoxy-3,4-dihydroquinolin-1(2H)-yl)-2-nitroethan-1-one | MDA-MB-231 | C43(0.96) | LDD2112 | [2] |
| LDCM0226 | AC11 | HEK-293T | C16(0.92) | LDD1509 | [8] |
| LDCM0278 | AC19 | HEK-293T | C16(0.81) | LDD1517 | [8] |
| LDCM0287 | AC27 | HEK-293T | C16(0.89) | LDD1526 | [8] |
| LDCM0290 | AC3 | HEK-293T | C16(0.93) | LDD1529 | [8] |
| LDCM0296 | AC35 | HEK-293T | C16(0.95) | LDD1535 | [8] |
| LDCM0305 | AC43 | HEK-293T | C16(1.11) | LDD1544 | [8] |
| LDCM0314 | AC51 | HEK-293T | C16(1.02) | LDD1553 | [8] |
| LDCM0322 | AC59 | HEK-293T | C16(0.97) | LDD1561 | [8] |
| LDCM0406 | CL19 | HEK-293T | C16(1.01) | LDD1610 | [8] |
| LDCM0420 | CL31 | HEK-293T | C16(0.98) | LDD1624 | [8] |
| LDCM0433 | CL43 | HEK-293T | C16(0.87) | LDD1637 | [8] |
| LDCM0446 | CL55 | HEK-293T | C16(0.96) | LDD1649 | [8] |
| LDCM0459 | CL67 | HEK-293T | C16(1.06) | LDD1662 | [8] |
| LDCM0462 | CL7 | HEK-293T | C16(0.87) | LDD1665 | [8] |
| LDCM0472 | CL79 | HEK-293T | C16(0.98) | LDD1675 | [8] |
| LDCM0486 | CL91 | HEK-293T | C16(0.97) | LDD1689 | [8] |
| LDCM0022 | KB02 | ICC10 | C117(1.44) | LDD2379 | [1] |
| LDCM0023 | KB03 | ICC10 | C117(1.89) | LDD2796 | [1] |
| LDCM0024 | KB05 | MOLM-13 | C117(2.28) | LDD3333 | [1] |
| LDCM0499 | Nucleophilic fragment 12b | MDA-MB-231 | C43(0.77) | LDD2092 | [2] |
| LDCM0500 | Nucleophilic fragment 13a | MDA-MB-231 | C43(1.08) | LDD2093 | [2] |
| LDCM0501 | Nucleophilic fragment 13b | MDA-MB-231 | C43(0.67) | LDD2094 | [2] |
| LDCM0503 | Nucleophilic fragment 14b | MDA-MB-231 | C43(0.68) | LDD2096 | [2] |
| LDCM0505 | Nucleophilic fragment 15b | MDA-MB-231 | C43(1.01) | LDD2098 | [2] |
| LDCM0516 | Nucleophilic fragment 21a | MDA-MB-231 | C43(0.73) | LDD2109 | [2] |
| LDCM0523 | Nucleophilic fragment 24b | MDA-MB-231 | C43(1.13) | LDD2116 | [2] |
| LDCM0526 | Nucleophilic fragment 26a | MDA-MB-231 | C43(0.98) | LDD2119 | [2] |
| LDCM0530 | Nucleophilic fragment 28a | MDA-MB-231 | C43(0.71) | LDD2123 | [2] |
| LDCM0534 | Nucleophilic fragment 30a | MDA-MB-231 | C43(0.93) | LDD2127 | [2] |
| LDCM0543 | Nucleophilic fragment 38 | MDA-MB-231 | C43(1.42) | LDD2136 | [2] |
| LDCM0550 | Nucleophilic fragment 5a | MDA-MB-231 | C43(1.58) | LDD2144 | [2] |
The Interaction Atlas With This Target
References













