Details of the Target
General Information of Target
| Target ID | LDTP06808 | |||||
|---|---|---|---|---|---|---|
| Target Name | Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21) | |||||
| Gene Name | VMA21 | |||||
| Gene ID | 203547 | |||||
| Synonyms |
MEAX; XMEA; Vacuolar ATPase assembly integral membrane protein VMA21; Myopathy with excessive autophagy protein |
|||||
| 3D Structure | ||||||
| Sequence |
MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMS
NRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQD |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
VMA21 family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function | Required for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum. {|HAMAP-Rule:MF_03058}. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C055 Probe Info |
![]() |
16.11 | LDD1752 | [1] | |
|
C056 Probe Info |
![]() |
24.59 | LDD1753 | [1] | |
|
C091 Probe Info |
![]() |
10.27 | LDD1782 | [1] | |
|
C094 Probe Info |
![]() |
27.67 | LDD1785 | [1] | |
|
C159 Probe Info |
![]() |
7.67 | LDD1839 | [1] | |
|
C161 Probe Info |
![]() |
10.63 | LDD1841 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Other






