Details of the Target

General Information of Target

Target ID LDTP05802
Target Name Serine/arginine-rich splicing factor 6 (SRSF6)
Gene Name SRSF6
Gene ID 6431
Synonyms
SFRS6; SRP55; Serine/arginine-rich splicing factor 6; Pre-mRNA-splicing factor SRP55; Splicing factor, arginine/serine-rich 6
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKEL
CGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSR
CSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIE
DKPRTSHRRSYSGSRSRSRSRRRSRSRSRRSSRSRSRSISKSRSRSRSRSKGRSRSRSKG
RKSRSKSKSKPKSDRGSHSHSRSRSKDEYEKSRSRSRSRSPKENGKGDIKSKSRSRSQSR
SNSPLPVPPSKARSVSPPPKRATSRSRSRSRSKSRSRSRSSSRD
Target Bioclass
Other
Family
Splicing factor SR family
Subcellular location
Nucleus
Function
Plays a role in constitutive splicing and modulates the selection of alternative splice sites. Plays a role in the alternative splicing of MAPT/Tau exon 10. Binds to alternative exons of TNC pre-mRNA and promotes the expression of alternatively spliced TNC. Plays a role in wound healing and in the regulation of keratinocyte differentiation and proliferation via its role in alternative splicing.
Uniprot ID
Q13247
Ensemble ID
ENST00000244020.5
HGNC ID
HGNC:10788
ChEMBL ID
CHEMBL5169149

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CAL148 SNV: p.E148Ter; p.R343T .
HCT116 Deletion: p.S222VfsTer68 .
HT115 SNV: p.R233Ter .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 27 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
P1
 Probe Info  		1.70  LDD0448  [1]
P3
 Probe Info  		1.94  LDD0450  [1]
C-Sul
 Probe Info  		7.24  LDD0066  [2]
YN-1
 Probe Info  		100.00  LDD0444  [3]
STPyne
 Probe Info  		K101(6.67); K165(3.51)  LDD0277  [4]
ONAyne
 Probe Info  		K182(0.00); K165(0.00); K143(0.00)  LDD0273  [4]
IPM
 Probe Info  		N.A.  LDD0241  [5]
Probe 1
 Probe Info  		Y82(9.75)  LDD3495  [6]
DBIA
 Probe Info  		C121(1.13)  LDD3313  [7]
BTD
 Probe Info  		C61(0.85)  LDD2089  [8]
ATP probe
 Probe Info  		K58(0.00); K165(0.00)  LDD0199  [9]
m-APA
 Probe Info  		N.A.  LDD2231  [10]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [11]
IA-alkyne
 Probe Info  		N.A.  LDD0036  [11]
IPIAA_H
 Probe Info  		N.A.  LDD0030  [12]
IPIAA_L
 Probe Info  		C121(0.00); C61(0.00)  LDD0031  [12]
ATP probe
 Probe Info  		N.A.  LDD0035  [13]
NAIA_4
 Probe Info  		N.A.  LDD2226  [14]
NPM
 Probe Info  		N.A.  LDD0016  [15]
SF
 Probe Info  		Y91(0.00); Y269(0.00); Y53(0.00); Y102(0.00)  LDD0028  [16]
TFBX
 Probe Info  		C61(0.00); C121(0.00)  LDD0148  [17]
1c-yne
 Probe Info  		N.A.  LDD0228  [18]
Acrolein
 Probe Info  		H69(0.00); C61(0.00)  LDD0217  [19]
Crotonaldehyde
 Probe Info  		C121(0.00); C61(0.00)  LDD0219  [19]
Methacrolein
 Probe Info  		N.A.  LDD0218  [19]
NAIA_5
 Probe Info  		C121(0.00); C61(0.00)  LDD2223  [14]
HHS-482
 Probe Info  		Y37(0.85)  LDD2239  [20]
PAL-AfBPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STS-1
 Probe Info  		N.A.  LDD0137  [21]
STS-2
 Probe Info  		N.A.  LDD0138  [21]
Staurosporine capture compound
 Probe Info  		N.A.  LDD0083  [22]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0548  1-(4-(Benzo[d][1,3]dioxol-5-ylmethyl)piperazin-1-yl)-2-nitroethan-1-one MDA-MB-231 C61(0.53)  LDD2142  [8]
 LDCM0519  1-(6-methoxy-3,4-dihydroquinolin-1(2H)-yl)-2-nitroethan-1-one MDA-MB-231 C61(1.19)  LDD2112  [8]
 LDCM0502  1-(Cyanoacetyl)piperidine MDA-MB-231 C61(0.93)  LDD2095  [8]
 LDCM0537  2-Cyano-N,N-dimethylacetamide MDA-MB-231 C121(0.99)  LDD2130  [8]
 LDCM0524  2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide MDA-MB-231 C61(1.19); C121(1.10)  LDD2117  [8]
 LDCM0510  3-(4-(Hydroxydiphenylmethyl)piperidin-1-yl)-3-oxopropanenitrile MDA-MB-231 C61(0.84)  LDD2103  [8]
 LDCM0108  Chloroacetamide HeLa H69(0.00); C121(0.00); C61(0.00)  LDD0222  [19]
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C121(0.98)  LDD1702  [8]
 LDCM0625  F8 Ramos C121(0.62)  LDD2187  [23]
 LDCM0572  Fragment10 Ramos C121(0.77)  LDD2189  [23]
 LDCM0573  Fragment11 Ramos C121(0.11)  LDD2190  [23]
 LDCM0574  Fragment12 Ramos C121(0.66)  LDD2191  [23]
 LDCM0575  Fragment13 Ramos C121(0.58)  LDD2192  [23]
 LDCM0576  Fragment14 Ramos C121(0.74)  LDD2193  [23]
 LDCM0579  Fragment20 Ramos C121(0.83)  LDD2194  [23]
 LDCM0580  Fragment21 Ramos C121(0.71)  LDD2195  [23]
 LDCM0582  Fragment23 Ramos C121(1.31)  LDD2196  [23]
 LDCM0578  Fragment27 Ramos C121(1.37)  LDD2197  [23]
 LDCM0586  Fragment28 Ramos C121(1.15)  LDD2198  [23]
 LDCM0588  Fragment30 Ramos C121(1.39)  LDD2199  [23]
 LDCM0589  Fragment31 Ramos C121(1.36)  LDD2200  [23]
 LDCM0590  Fragment32 Ramos C121(0.63)  LDD2201  [23]
 LDCM0468  Fragment33 Ramos C121(1.14)  LDD2202  [23]
 LDCM0596  Fragment38 Ramos C121(0.33)  LDD2203  [23]
 LDCM0566  Fragment4 Ramos C121(0.73)  LDD2184  [23]
 LDCM0614  Fragment56 Ramos C121(0.65)  LDD2205  [23]
 LDCM0569  Fragment7 Ramos C121(0.68)  LDD2186  [23]
 LDCM0571  Fragment9 Ramos C121(0.75)  LDD2188  [23]
 LDCM0107  IAA HeLa H69(0.00); H142(0.00); C61(0.00)  LDD0221  [19]
 LDCM0022  KB02 Ramos C121(0.48)  LDD2182  [23]
 LDCM0023  KB03 MDA-MB-231 C121(1.92)  LDD1701  [8]
 LDCM0024  KB05 Hs 936.T C121(1.13)  LDD3313  [7]
 LDCM0109  NEM HeLa H142(0.00); H69(0.00)  LDD0223  [19]
 LDCM0496  Nucleophilic fragment 11a MDA-MB-231 C61(0.85)  LDD2089  [8]
 LDCM0505  Nucleophilic fragment 15b MDA-MB-231 C61(0.82)  LDD2098  [8]
 LDCM0506  Nucleophilic fragment 16a MDA-MB-231 C61(1.34); C121(1.38)  LDD2099  [8]
 LDCM0507  Nucleophilic fragment 16b MDA-MB-231 C61(0.59)  LDD2100  [8]
 LDCM0511  Nucleophilic fragment 18b MDA-MB-231 C121(0.49)  LDD2104  [8]
 LDCM0514  Nucleophilic fragment 20a MDA-MB-231 C61(1.22); C121(1.11)  LDD2107  [8]
 LDCM0515  Nucleophilic fragment 20b MDA-MB-231 C61(1.15)  LDD2108  [8]
 LDCM0521  Nucleophilic fragment 23b MDA-MB-231 C121(0.36)  LDD2114  [8]
 LDCM0527  Nucleophilic fragment 26b MDA-MB-231 C61(0.79)  LDD2120  [8]
 LDCM0530  Nucleophilic fragment 28a MDA-MB-231 C61(1.02); C121(1.01)  LDD2123  [8]
 LDCM0531  Nucleophilic fragment 28b MDA-MB-231 C61(0.45)  LDD2124  [8]
 LDCM0532  Nucleophilic fragment 29a MDA-MB-231 C61(1.04); C121(0.84)  LDD2125  [8]
 LDCM0533  Nucleophilic fragment 29b MDA-MB-231 C61(0.80)  LDD2126  [8]
 LDCM0535  Nucleophilic fragment 30b MDA-MB-231 C61(0.86)  LDD2128  [8]
 LDCM0543  Nucleophilic fragment 38 MDA-MB-231 C121(1.25)  LDD2136  [8]
 LDCM0544  Nucleophilic fragment 39 MDA-MB-231 C61(0.99)  LDD2137  [8]
 LDCM0546  Nucleophilic fragment 40 MDA-MB-231 C61(0.98)  LDD2140  [8]
 LDCM0549  Nucleophilic fragment 43 MDA-MB-231 C61(0.96)  LDD2143  [8]
 LDCM0550  Nucleophilic fragment 5a MDA-MB-231 C61(3.70)  LDD2144  [8]
 LDCM0551  Nucleophilic fragment 5b MDA-MB-231 C61(1.54)  LDD2145  [8]
 LDCM0019  Staurosporine Hep-G2 N.A.  LDD0083  [22]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Putative RNA-binding protein Luc7-like 2 (LUC7L2) Luc7 family Q9Y383

References

1 Comparison of Different Competitive Proteome Profiling Approaches in Target Identification of Covalent Inhibitors. Chembiochem. 2022 Dec 16;23(24):e202200389. doi: 10.1002/cbic.202200389. Epub 2022 Nov 22.
2 Low-Toxicity Sulfonium-Based Probes for Cysteine-Specific Profiling in Live Cells. Anal Chem. 2022 Mar 15;94(10):4366-4372. doi: 10.1021/acs.analchem.1c05129. Epub 2022 Mar 4.
3 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
4 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
5 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
6 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
7 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
8 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
9 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
10 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
11 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
12 SP3-Enabled Rapid and High Coverage Chemoproteomic Identification of Cell-State-Dependent Redox-Sensitive Cysteines. Mol Cell Proteomics. 2022 Apr;21(4):100218. doi: 10.1016/j.mcpro.2022.100218. Epub 2022 Feb 25.
Mass spectrometry data entry: PXD029500 , PXD031647
13 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096
14 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
15 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
16 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
17 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
18 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
19 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
20 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
21 Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.
22 Comprehensive identification of staurosporine-binding kinases in the hepatocyte cell line HepG2 using Capture Compound Mass Spectrometry (CCMS). J Proteome Res. 2010 Feb 5;9(2):806-17. doi: 10.1021/pr9007333.
23 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578