General Information of Target

Target ID LDTP05478
Target Name Tyrosine-protein kinase BTK (BTK)
Gene Name BTK
Gene ID 695
Synonyms
AGMX1; ATK; BPK; Tyrosine-protein kinase BTK; EC 2.7.10.2; Agammaglobulinemia tyrosine kinase; ATK; B-cell progenitor kinase; BPK; Bruton tyrosine kinase
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDE
YFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK
EGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN
YHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK
WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF
GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER
FTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES
Target Type
Successful
Target Bioclass
Enzyme
Family
Protein kinase superfamily, Tyr protein kinase family, TEC subfamily
Subcellular location
Cytoplasm
Function
Non-receptor tyrosine kinase indispensable for B lymphocyte development, differentiation and signaling. Binding of antigen to the B-cell antigen receptor (BCR) triggers signaling that ultimately leads to B-cell activation. After BCR engagement and activation at the plasma membrane, phosphorylates PLCG2 at several sites, igniting the downstream signaling pathway through calcium mobilization, followed by activation of the protein kinase C (PKC) family members. PLCG2 phosphorylation is performed in close cooperation with the adapter protein B-cell linker protein BLNK. BTK acts as a platform to bring together a diverse array of signaling proteins and is implicated in cytokine receptor signaling pathways. Plays an important role in the function of immune cells of innate as well as adaptive immunity, as a component of the Toll-like receptors (TLR) pathway. The TLR pathway acts as a primary surveillance system for the detection of pathogens and are crucial to the activation of host defense. Especially, is a critical molecule in regulating TLR9 activation in splenic B-cells. Within the TLR pathway, induces tyrosine phosphorylation of TIRAP which leads to TIRAP degradation. BTK also plays a critical role in transcription regulation. Induces the activity of NF-kappa-B, which is involved in regulating the expression of hundreds of genes. BTK is involved on the signaling pathway linking TLR8 and TLR9 to NF-kappa-B. Acts as an activator of NLRP3 inflammasome assembly by mediating phosphorylation of NLRP3. Transiently phosphorylates transcription factor GTF2I on tyrosine residues in response to BCR. GTF2I then translocates to the nucleus to bind regulatory enhancer elements to modulate gene expression. ARID3A and NFAT are other transcriptional target of BTK. BTK is required for the formation of functional ARID3A DNA-binding complexes. There is however no evidence that BTK itself binds directly to DNA. BTK has a dual role in the regulation of apoptosis.
TTD ID
T25005
Uniprot ID
Q06187
DrugMap ID
TTOWPER
Ensemble ID
ENST00000308731.8
HGNC ID
HGNC:1133
ChEMBL ID
CHEMBL5251

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
A431 SNV: p.I197M .
CAL148 SNV: p.Q379Ter .
CCK81 SNV: p.V113I .
CHL1 Deletion: p.E301KfsTer30 .
DOTC24510 SNV: p.K503R .
LUDLU1 Substitution: p.P210K .
MDAMB436 Deletion: p.R133WfsTer38 .
NCIH1666 SNV: p.G47R .
NCIH1993 SNV: p.E439Ter .
ONS76 SNV: p.T495S .
PC9 SNV: p.G302R .
RL952 SNV: p.M489I .
RVH421 SNV: p.P74L .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
A-EBA
 Probe Info 
9.79  LDD0214  [1]
IBr-1b
 Probe Info 
C481(20.00)  LDD0306  [2]
IA-alkyne
 Probe Info 
C527(1.39)  LDD0304  [3]
DBIA
 Probe Info 
C536(3.85); C371(2.36); C97(3.73); C498(3.69)  LDD3333  [4]
PAL-AfBPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
FFF probe11
 Probe Info 
7.95  LDD0472  [5]
FFF probe13
 Probe Info 
13.60  LDD0476  [5]
FFF probe3
 Probe Info 
11.85  LDD0465  [5]
VE-P
 Probe Info 
N.A.  LDD0396  [6]
Dasatinib-CA-3PAP
 Probe Info 
N.A.  LDD0365  [7]
Dasatinib-CA-8PAP
 Probe Info 
N.A.  LDD0364  [7]
DA-2
 Probe Info 
N.A.  LDD0070  [8]
STS-1
 Probe Info 
N.A.  LDD0068  [9]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0097  Dasatinib K562 N.A.  LDD0364  [7]
 LDCM0625  F8 Ramos C464(1.52); C527(0.61); C337(4.46)  LDD2187  [10]
 LDCM0572  Fragment10 Ramos C464(0.46); C527(0.93); C165(0.93)  LDD2189  [10]
 LDCM0573  Fragment11 Ramos C464(2.17); C337(20.00)  LDD2190  [10]
 LDCM0574  Fragment12 Ramos C464(0.86); C527(0.59); C165(0.41)  LDD2191  [10]
 LDCM0575  Fragment13 Ramos C527(0.76); C165(1.01)  LDD2192  [10]
 LDCM0576  Fragment14 Ramos C165(0.85); C337(0.73)  LDD2193  [10]
 LDCM0579  Fragment20 Ramos C464(0.46); C527(0.57); C165(0.64)  LDD2194  [10]
 LDCM0580  Fragment21 Ramos C527(0.67); C165(0.83)  LDD2195  [10]
 LDCM0582  Fragment23 Ramos C527(0.67); C165(0.57)  LDD2196  [10]
 LDCM0578  Fragment27 Ramos C527(0.84); C165(0.87)  LDD2197  [10]
 LDCM0586  Fragment28 Ramos C527(0.88); C165(0.71)  LDD2198  [10]
 LDCM0588  Fragment30 Ramos C464(0.88); C527(0.58); C165(0.96)  LDD2199  [10]
 LDCM0589  Fragment31 Ramos C527(1.10); C165(1.13)  LDD2200  [10]
 LDCM0590  Fragment32 Ramos C464(0.43); C527(0.30); C165(0.35)  LDD2201  [10]
 LDCM0468  Fragment33 Ramos C464(0.37); C527(0.31); C165(0.53)  LDD2202  [10]
 LDCM0596  Fragment38 Ramos C464(1.13); C527(0.53); C165(0.84)  LDD2203  [10]
 LDCM0566  Fragment4 Ramos C527(0.32); C337(0.31)  LDD2184  [10]
 LDCM0610  Fragment52 Ramos C527(0.90); C165(0.94)  LDD2204  [10]
 LDCM0614  Fragment56 Ramos C464(2.14); C527(0.98)  LDD2205  [10]
 LDCM0569  Fragment7 Ramos C464(0.85); C527(0.84); C337(0.19)  LDD2186  [10]
 LDCM0571  Fragment9 Ramos C464(0.38); C527(0.68); C165(0.53)  LDD2188  [10]
 LDCM0022  KB02 Ramos C464(1.41); C527(0.99); C337(0.48)  LDD2182  [10]
 LDCM0023  KB03 Ramos C464(0.48); C527(0.56); C337(0.41)  LDD2183  [10]
 LDCM0024  KB05 MOLM-13 C536(3.85); C371(2.36); C97(3.73); C498(3.69)  LDD3333  [4]
 LDCM0131  RA190 MM1.R C527(1.39)  LDD0304  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein kinase C theta type (PRKCQ) AGC Ser/Thr protein kinase family Q04759
Tyrosine-protein kinase BTK (BTK) Tyr protein kinase family Q06187
Disintegrin and metalloproteinase domain-containing protein 15 (ADAM15) . Q13444
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Heat shock protein HSP 90-beta (HSP90AB1) Heat shock protein 90 family P08238
Myelin and lymphocyte protein (MAL) MAL family P21145
Transcription factor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
General transcription factor II-I (GTF2I) TFII-I family P78347
AT-rich interactive domain-containing protein 3A (ARID3A) . Q99856
Homeobox protein MOX-2 (MEOX2) . P50222
Other
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
SH3 domain-binding protein 5 (SH3BP5) SH3BP5 family O60239
Actin nucleation-promoting factor WAS (WAS) . P42768
B-cell linker protein (BLNK) . Q8WV28

The Drug(s) Related To This Target

Approved
Click To Hide/Show 5 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Dasatinib Small molecular drug DB01254
Fostamatinib Small molecular drug DB12010
Ibrutinib Small molecular drug D09KTS
Acalabrutinib . D09PQZ
Zanubrutinib . D0UT4W
Phase 3
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Icp-022 Small molecular drug DUTJ12
Pirtobrutinib Small molecular drug DXP04H
Gdc-0853 . D0A9PN
Phase 2
Click To Hide/Show 12 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Cc-292 Small molecular drug D04BFC
Cg-806 Small molecular drug DT3BA1
Dtrm-555 Small molecular drug DVS81T
Acp-319 . D0UF0N
Arq 531 . D0KQ7M
Bgb-3112 . D0E8PG
Bms-986142 . D08AOZ
Gs-4059 . D0H0KH
Lou064 . D0C0OB
M2951 . D0QX8X
Prn1008 . D0GH7L
Vecabrutinib . D0YI4F
Phase 1
Click To Hide/Show 11 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Dtrmwxhs-12 Small molecular drug D3Q4SZ
Hm71224 Small molecular drug DTF20P
Tg-1701 Small molecular drug DQ21NM
Ac0058ta . D0KT8D
Bgb-3113 . D05SGI
Biib068 . D0WP9A
Jnj-64264681 . DBO39X
M7583 . D08SGE
Ono-4059 . D02MRX
Prn2246 . D09NVR
Tak-020 . D0VS3U
Preclinical
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Pci-45292 . D0D4AQ
Investigative
Click To Hide/Show 15 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Cgi-1316 Small molecular drug D0H3JH
Inositol 1,3,4,5-tetrakisphosphate Small molecular drug D0MH9X
Inositol 1345-tetrakisphosphate Small molecular drug DB01863
Lfm-a13 Small molecular drug D08NTB
Pmid24900538c2c Small molecular drug D0E7VO
Pmid24915291c31 Small molecular drug D01RHR
Pmid24915291c38 Small molecular drug D06BJG
Rn486 Small molecular drug D0N0LN
Spebrutinib Small molecular drug DB11764
Abivertinib . DB15327
Branebrutinib . DB15347
Evobrutinib . DB15170
Fenebrutinib . DB14785
Tirabrutinib . DB15227
Xl418 . DB05204
Patented
Click To Hide/Show 26 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Imidazopyridine Derivative 4 Small molecular drug D0P3UH
Pmid27774824-compound-figure12example1 Small molecular drug D0NK1R
Pmid27774824-compound-figure12example10 Small molecular drug D0UH8J
Pmid27774824-compound-figure12example61 Small molecular drug D00BYK
Pyrrolo[2,3-d]Pyrimidine Derivative 12 Small molecular drug D0QW4H
Pyrrolo[2,3-d]Pyrimidine Derivative 13 Small molecular drug D03ULH
Pyrrolo[2,3-d]Pyrimidine Derivative 14 Small molecular drug D00KEX
Pyrrolo[2,3-d]Pyrimidine Derivative 15 Small molecular drug D09TKO
Pyrrolo[2,3-d]Pyrimidine Derivative 16 Small molecular drug D06ZNU
Pyrrolo[2,3-d]Pyrimidine Derivative 17 Small molecular drug D0V8JZ
Pyrrolo[2,3-d]Pyrimidine Derivative 18 Small molecular drug D0WN2X
Pyrrolo[2,3-d]Pyrimidine Derivative 19 Small molecular drug D00KPQ
Pyrrolo[2,3-d]Pyrimidine Derivative 20 Small molecular drug D0Q1BE
Pyrrolo[2,3-d]Pyrimidine Derivative 21 Small molecular drug D0TI0R
Pyrrolo[2,3-d]Pyrimidine Derivative 22 Small molecular drug D0SR0U
Pyrrolo[2,3-d]Pyrimidine Derivative 23 Small molecular drug D09IOW
Pyrrolo[2,3-d]Pyrimidine Derivative 25 Small molecular drug D0CG3V
Pyrrolo[2,3-d]Pyrimidine Derivative 26 Small molecular drug D0R9HP
Pyrrolo[2,3-d]Pyrimidine Derivative 27 Small molecular drug D0IX7O
Pyrrolo[2,3-d]Pyrimidine Derivative 28 Small molecular drug D00GTY
Pyrrolo[2,3-d]Pyrimidine Derivative 29 Small molecular drug D05UXK
Pyrrolo[2,3-d]Pyrimidine Derivative 30 Small molecular drug D05YNZ
Pyrrolo[2,3-d]Pyrimidine Derivative 31 Small molecular drug D0W3BE
Pyrrolo[2,3-d]Pyrimidine Derivative 32 Small molecular drug D0Q8LH
Pyrrolo[2,3-d]Pyrimidine Derivative 33 Small molecular drug D0J8UO
Pyrazolo[4,3-c]Pyridine Derivative 2 . D09PIS
Discontinued
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Gdc-0834 Small molecular drug D03FUO

References

1 2-Ethynylbenzaldehyde-Based, Lysine-Targeting Irreversible Covalent Inhibitors for Protein Kinases and Nonkinases. J Am Chem Soc. 2023 Feb 12. doi: 10.1021/jacs.2c11595. Online ahead of print.
Mass spectrometry data entry: PXD037665
2 Site-Specific Labeling of Endogenous Proteins Using CoLDR Chemistry. J Am Chem Soc. 2021 Dec 8;143(48):20095-20108. doi: 10.1021/jacs.1c06167. Epub 2021 Nov 24.
3 Physical and Functional Analysis of the Putative Rpn13 Inhibitor RA190. Cell Chem Biol. 2020 Nov 19;27(11):1371-1382.e6. doi: 10.1016/j.chembiol.2020.08.007. Epub 2020 Aug 27.
4 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
5 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.
6 Pharmacological Targeting of Vacuolar H(+)-ATPase via Subunit V1G Combats Multidrug-Resistant Cancer. Cell Chem Biol. 2020 Nov 19;27(11):1359-1370.e8. doi: 10.1016/j.chembiol.2020.06.011. Epub 2020 Jul 9.
7 Streamlined Target Deconvolution Approach Utilizing a Single Photoreactive Chloroalkane Capture Tag. ACS Chem Biol. 2021 Feb 19;16(2):404-413. doi: 10.1021/acschembio.0c00987. Epub 2021 Feb 5.
8 Cell-based proteome profiling of potential dasatinib targets by use of affinity-based probes. J Am Chem Soc. 2012 Feb 15;134(6):3001-14. doi: 10.1021/ja208518u. Epub 2012 Feb 1.
9 Proteome profiling reveals potential cellular targets of staurosporine using a clickable cell-permeable probe. Chem Commun (Camb). 2011 Oct 28;47(40):11306-8. doi: 10.1039/c1cc14824a. Epub 2011 Sep 16.
10 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578