Details of the Target
General Information of Target
| Target ID | LDTP16717 | |||||
|---|---|---|---|---|---|---|
| Target Name | Forkhead-associated domain-containing protein 1 (FHAD1) | |||||
| Gene Name | FHAD1 | |||||
| Gene ID | 114827 | |||||
| Synonyms |
KIAA1937; Forkhead-associated domain-containing protein 1; FHA domain-containing protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MAPHLLWCPTNGLGLGGSPAGQWGGGSHYRGLVPGEPAGRPPALPLPGLAGLHDHTQLLR
MAGQPWLAWGTAAARVSARPTRDCSCTSRCHHACDVVAVTLS |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K1374(1.20); K961(10.00) | LDD0277 | [1] | |
|
ONAyne Probe Info |
![]() |
K1374(5.88) | LDD0275 | [1] | |
|
N1 Probe Info |
![]() |
N.A. | LDD0245 | [2] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C008 Probe Info |
![]() |
10.06 | LDD1717 | [3] | |
|
C010 Probe Info |
![]() |
19.16 | LDD1719 | [3] | |
|
C011 Probe Info |
![]() |
9.78 | LDD1720 | [3] | |
|
C376 Probe Info |
![]() |
15.56 | LDD2036 | [3] | |
|
C380 Probe Info |
![]() |
31.34 | LDD2039 | [3] | |
|
C382 Probe Info |
![]() |
34.30 | LDD2041 | [3] | |
References









