Details of the Target
General Information of Target
Target ID | LDTP12784 | |||||
---|---|---|---|---|---|---|
Target Name | Pyroglutamyl-peptidase 1 (PGPEP1) | |||||
Gene Name | PGPEP1 | |||||
Gene ID | 54858 | |||||
Synonyms |
PGPI; Pyroglutamyl-peptidase 1; EC 3.4.19.3; 5-oxoprolyl-peptidase; Pyroglutamyl aminopeptidase I; PAP-I; Pyroglutamyl-peptidase I; PGP-I; Pyrrolidone-carboxylate peptidase |
|||||
3D Structure | ||||||
Sequence |
MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCPRLPKLLACQH
AFCAICLKLLLCVQDNTWSITCPLCRKVTAVPGGLICSLRDHEAVVGQLAQPCTEVSLCP QGLVDPADLAAGHPSLVGEDGQDEVSANHVAARRLAAHLLLLALLIILIGPFIYPGVLRW VLTFIIALALLMSTLFCCLPSTRGSCWPSSRTLFCREQKHSHISSIA |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Peptidase C15 family
|
|||||
Subcellular location |
Cytoplasm
|
|||||
Function | Removes 5-oxoproline from various penultimate amino acid residues except L-proline. | |||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Cell line | Mutation details | Probe for labeling this protein in this cell | |||
---|---|---|---|---|---|
JURKAT | SNV: p.R183K | . | |||
MFE319 | SNV: p.T152A | DBIA Probe Info | |||
RCC10RGB | SNV: p.Q142R | . | |||
RKO | SNV: p.Ter210RextTer147 | DBIA Probe Info |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C99(12.16) | LDD0209 | [1] | |
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [2] | |
IA-alkyne Probe Info |
![]() |
N.A. | LDD0036 | [2] | |
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [2] | |
IPM Probe Info |
![]() |
N.A. | LDD0025 | [3] | |
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [4] | |
NAIA_5 Probe Info |
![]() |
C206(0.00); C87(0.00) | LDD2223 | [4] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0630 | CCW28-3 | 231MFP | C149(1.37) | LDD2214 | [5] |
LDCM0632 | CL-Sc | Hep-G2 | C206(20.00); C149(0.72); C206(0.31); C87(0.19) | LDD2227 | [4] |
LDCM0198 | Dimethyl Fumarate(DMF) | T cell | C149(7.50) | LDD0513 | [6] |
LDCM0201 | EV-3 | T cell | C149(6.29) | LDD0515 | [6] |
LDCM0202 | EV-93 | T cell | C149(5.00) | LDD0527 | [6] |
LDCM0572 | Fragment10 | Ramos | C149(11.02) | LDD1466 | [7] |
LDCM0573 | Fragment11 | Ramos | C149(1.31) | LDD2190 | [8] |
LDCM0574 | Fragment12 | MDA-MB-231 | C149(3.93) | LDD1468 | [7] |
LDCM0575 | Fragment13 | Ramos | C149(20.00) | LDD1470 | [7] |
LDCM0576 | Fragment14 | Ramos | C149(0.91) | LDD2193 | [8] |
LDCM0566 | Fragment4 | MDA-MB-231 | C149(20.00) | LDD1461 | [7] |
LDCM0569 | Fragment7 | Ramos | C149(1.32) | LDD2186 | [8] |
LDCM0571 | Fragment9 | Ramos | C149(20.00) | LDD1464 | [7] |
LDCM0022 | KB02 | T cell | C149(17.69) | LDD1703 | [6] |
LDCM0023 | KB03 | Jurkat | C99(12.16) | LDD0209 | [1] |
LDCM0024 | KB05 | COLO792 | C99(1.65) | LDD3310 | [9] |
LDCM0169 | KB63 | Ramos | 20.00 | LDD0432 | [10] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Aquaporin-1 (AQP1) | MIP/aquaporin (TC 1.A.8) family | P29972 |
References