General Information of Target

Target ID LDTP09838
Target Name Sortilin-related receptor (SORL1)
Gene Name SORL1
Gene ID 6653
Synonyms
C11orf32; Sortilin-related receptor; Low-density lipoprotein receptor relative with 11 ligand-binding repeats; LDLR relative with 11 ligand-binding repeats; LR11; SorLA-1; Sorting protein-related receptor containing LDLR class A repeats; SorLA
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAIQFRSLFPLALPGMLALLGWWWFFSRKKGHVSSHDEQQVEAGAVQLRADPAIKEPLPV
EDVCPKVVSTPPSVTEPPEKELSTVSKLPAEPPALLQTHPPCRRSESSGILPNTTDMRLR
PGTRRDDSTKLELALTGGEAKSIPLECPLSSPKGVLFSSKSAEVCKQDSPFSRVPRKVQP
GYPVVPAEKRSSGERARETGGAEGTGDAVLGEKVLEEALLSREHVLELENSKGPSLASLE
GEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFIESAHTELAKDDAAPAPPVADAKAQDRGV
EGELGNEESLDRNEEGLDRNEEGLDRNEESLDRNEEGLDRNEEIKRAAFQIISQVISEAT
EQVLATTVGKVAGRVCQASQLQGQKEESCVPVHQKTVLGPDTAEPATAEAAVAPPDAGLP
LPGLPAEGSPPPKTYVSCLKSLLSSPTKDSKPNISAHHISLASCLALTTPSEELPDRAGI
LVEDATCVTCMSDSSQSVPLVASPGHCSDSFSTSGLEDSCTETSSSPRDKAITPPLPEST
VPFSNGVLKGELSDLGAEDGWTMDAEADHSGGSDRNSMDSVDSCCSLKKTESFQNAQAGS
NPKKVDLIIWEIEVPKHLVGRLIGKQGRYVSFLKQTSGAKIYISTLPYTQSVQICHIEGS
QHHVDKALNLIGKKFKELNLTNIYAPPLPSLALPSLPMTSWLMLPDGITVEVIVVNQVNA
GHLFVQQHTHPTFHALRSLDQQMYLCYSQPGIPTLPTPVEITVICAAPGADGAWWRAQVV
ASYEETNEVEIRYVDYGGYKRVKVDVLRQIRSDFVTLPFQGAEVLLDSVMPLSDDDQFSP
EADAAMSEMTGNTALLAQVTSYSPTGLPLIQLWSVVGDEVVLINRSLVERGLAQWVDSYY
TSL
Target Bioclass
Transporter and channel
Family
VPS10-related sortilin family, SORL1 subfamily
Subcellular location
Golgi apparatus membrane
Function
Sorting receptor that directs several proteins to their correct location within the cell (Probable). Along with AP-1 complex, involved Golgi apparatus - endosome sorting. Sorting receptor for APP, regulating its intracellular trafficking and processing into amyloidogenic-beta peptides. Retains APP in the trans-Golgi network, hence preventing its transit through late endosomes where amyloid beta peptides Abeta40 and Abeta42 are generated. May also sort newly produced amyloid-beta peptides to lysosomes for catabolism. Does not affect APP trafficking from the endoplasmic reticulum to Golgi compartments. Sorting receptor for the BDNF receptor NTRK2/TRKB that facilitates NTRK2 trafficking between synaptic plasma membranes, postsynaptic densities and cell soma, hence positively regulates BDNF signaling by controlling the intracellular location of its receptor. Sorting receptor for GDNF that promotes GDNF regulated, but not constitutive secretion. Sorting receptor for the GDNF-GFRA1 complex, directing it from the cell surface to endosomes. GDNF is then targeted to lysosomes and degraded, while its receptor GFRA1 recycles back to the cell membrane, resulting in a GDNF clearance pathway. The SORL1-GFRA1 complex further targets RET for endocytosis, but not for degradation, affecting GDNF-induced neurotrophic activities. Sorting receptor for ERBB2/HER2. Regulates ERBB2 subcellular distribution by promoting its recycling after internalization from endosomes back to the plasma membrane, hence stimulating phosphoinositide 3-kinase (PI3K)-dependent ERBB2 signaling. In ERBB2-dependent cancer cells, promotes cell proliferation. Sorting receptor for lipoprotein lipase LPL. Promotes LPL localization to endosomes and later to the lysosomes, leading to degradation of newly synthesized LPL. Potential sorting receptor for APOA5, inducing APOA5 internalization to early endosomes, then to late endosomes, wherefrom a portion is sent to lysosomes and degradation, another portion is sorted to the trans-Golgi network. Sorting receptor for the insulin receptor INSR. Promotes recycling of internalized INSR via the Golgi apparatus back to the cell surface, thereby preventing lysosomal INSR catabolism, increasing INSR cell surface expression and strengthening insulin signal reception in adipose tissue. Does not affect INSR internalization. Plays a role in renal ion homeostasis, controlling the phospho-regulation of SLC12A1/NKCC2 by STK39/SPAK kinase and PPP3CB/calcineurin A beta phosphatase, possibly through intracellular sorting of STK39 and PPP3CB. Stimulates, via the N-terminal ectodomain, the proliferation and migration of smooth muscle cells, possibly by increasing cell surface expression of the urokinase receptor uPAR/PLAUR. This may promote extracellular matrix proteolysis and hence facilitate cell migration. By acting on the migration of intimal smooth muscle cells, may accelerate intimal thickening following vascular injury. Promotes adhesion of monocytes. Stimulates proliferation and migration of monocytes/macrophages. Through its action on intimal smooth muscle cells and macrophages, may accelerate intimal thickening and macrophage foam cell formation in the process of atherosclerosis. Regulates hypoxia-enhanced adhesion of hematopoietic stem and progenitor cells to the bone marrow stromal cells via a PLAUR-mediated pathway. This function is mediated by the N-terminal ectodomain. Metabolic regulator, which functions to maintain the adequate balance between lipid storage and oxidation in response to changing environmental conditions, such as temperature and diet. The N-terminal ectodomain negatively regulates adipose tissue energy expenditure, acting through the inhibition the BMP/Smad pathway. May regulate signaling by the heterodimeric neurotrophic cytokine CLCF1-CRLF1 bound to the CNTFR receptor by promoting the endocytosis of the tripartite complex CLCF1-CRLF1-CNTFR and lysosomal degradation. May regulate IL6 signaling, decreasing cis signaling, possibly by interfering with IL6-binding to membrane-bound IL6R, while up-regulating trans signaling via soluble IL6R.
Uniprot ID
Q92673
Ensemble ID
ENST00000260197.12
HGNC ID
HGNC:11185

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 6 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
FBPP2
 Probe Info 
4.41  LDD0318  [1]
DBIA
 Probe Info 
C1549(2.27)  LDD3312  [2]
4-Iodoacetamidophenylacetylene
 Probe Info 
C752(0.00); C1078(0.00)  LDD0038  [3]
IA-alkyne
 Probe Info 
N.A.  LDD0163  [4]
NAIA_5
 Probe Info 
C1376(0.00); C1381(0.00)  LDD2224  [5]
IPM
 Probe Info 
C1117(0.00); C1125(0.00); C1491(0.00)  LDD2156  [6]
PAL-AfBPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C170
 Probe Info 
29.65  LDD1850  [7]
C171
 Probe Info 
8.69  LDD1851  [7]
C310
 Probe Info 
25.46  LDD1977  [7]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0215  AC10 HEK-293T C643(0.98)  LDD1508  [8]
 LDCM0226  AC11 HEK-293T C643(1.01)  LDD1509  [8]
 LDCM0259  AC14 HEK-293T C1549(0.94)  LDD1512  [8]
 LDCM0270  AC15 HEK-293T C1549(1.06)  LDD1513  [8]
 LDCM0277  AC18 HEK-293T C643(1.02)  LDD1516  [8]
 LDCM0278  AC19 HEK-293T C643(1.27)  LDD1517  [8]
 LDCM0279  AC2 HEK-293T C643(0.98)  LDD1518  [8]
 LDCM0282  AC22 HEK-293T C1549(0.73)  LDD1521  [8]
 LDCM0283  AC23 HEK-293T C1549(0.96)  LDD1522  [8]
 LDCM0284  AC24 HEK-293T C643(1.03)  LDD1523  [8]
 LDCM0286  AC26 HEK-293T C643(1.05)  LDD1525  [8]
 LDCM0287  AC27 HEK-293T C643(0.99)  LDD1526  [8]
 LDCM0290  AC3 HEK-293T C643(1.06)  LDD1529  [8]
 LDCM0291  AC30 HEK-293T C1549(0.78)  LDD1530  [8]
 LDCM0292  AC31 HEK-293T C1549(1.07)  LDD1531  [8]
 LDCM0293  AC32 HEK-293T C643(1.09)  LDD1532  [8]
 LDCM0295  AC34 HEK-293T C643(1.07)  LDD1534  [8]
 LDCM0296  AC35 HEK-293T C643(1.05)  LDD1535  [8]
 LDCM0299  AC38 HEK-293T C1549(0.88)  LDD1538  [8]
 LDCM0300  AC39 HEK-293T C1549(0.98)  LDD1539  [8]
 LDCM0302  AC40 HEK-293T C643(0.99)  LDD1541  [8]
 LDCM0304  AC42 HEK-293T C643(1.11)  LDD1543  [8]
 LDCM0305  AC43 HEK-293T C643(1.11)  LDD1544  [8]
 LDCM0308  AC46 HEK-293T C1549(1.13)  LDD1547  [8]
 LDCM0309  AC47 HEK-293T C1549(1.03)  LDD1548  [8]
 LDCM0310  AC48 HEK-293T C643(1.07)  LDD1549  [8]
 LDCM0313  AC50 HEK-293T C643(1.12)  LDD1552  [8]
 LDCM0314  AC51 HEK-293T C643(1.10)  LDD1553  [8]
 LDCM0317  AC54 HEK-293T C1549(0.88)  LDD1556  [8]
 LDCM0318  AC55 HEK-293T C1549(0.98)  LDD1557  [8]
 LDCM0319  AC56 HEK-293T C643(1.03)  LDD1558  [8]
 LDCM0321  AC58 HEK-293T C643(1.07)  LDD1560  [8]
 LDCM0322  AC59 HEK-293T C643(1.06)  LDD1561  [8]
 LDCM0323  AC6 HEK-293T C1549(0.82)  LDD1562  [8]
 LDCM0326  AC62 HEK-293T C1549(0.69)  LDD1565  [8]
 LDCM0327  AC63 HEK-293T C1549(1.10)  LDD1566  [8]
 LDCM0328  AC64 HEK-293T C643(1.15)  LDD1567  [8]
 LDCM0334  AC7 HEK-293T C1549(1.02)  LDD1568  [8]
 LDCM0345  AC8 HEK-293T C643(0.99)  LDD1569  [8]
 LDCM0275  AKOS034007705 HEK-293T C643(0.98)  LDD1514  [8]
 LDCM0020  ARS-1620 HCC44 C1431(0.95); C1438(0.95)  LDD2171  [9]
 LDCM0367  CL1 HEK-293T C1549(1.28); C752(0.68)  LDD1571  [8]
 LDCM0368  CL10 HEK-293T C1549(1.10)  LDD1572  [8]
 LDCM0370  CL101 HEK-293T C1549(1.14); C752(0.95)  LDD1574  [8]
 LDCM0371  CL102 HEK-293T C1549(1.00)  LDD1575  [8]
 LDCM0374  CL105 HEK-293T C1549(1.18); C752(0.79)  LDD1578  [8]
 LDCM0375  CL106 HEK-293T C1549(0.90)  LDD1579  [8]
 LDCM0378  CL109 HEK-293T C1549(1.01); C752(1.01)  LDD1582  [8]
 LDCM0379  CL11 HEK-293T C1549(1.25)  LDD1583  [8]
 LDCM0380  CL110 HEK-293T C1549(0.86)  LDD1584  [8]
 LDCM0383  CL113 HEK-293T C1549(1.10); C752(0.97)  LDD1587  [8]
 LDCM0384  CL114 HEK-293T C1549(0.93)  LDD1588  [8]
 LDCM0387  CL117 HEK-293T C1549(1.06); C752(0.97)  LDD1591  [8]
 LDCM0388  CL118 HEK-293T C1549(1.01)  LDD1592  [8]
 LDCM0390  CL12 HEK-293T C643(1.09)  LDD1594  [8]
 LDCM0392  CL121 HEK-293T C1549(1.14); C752(1.04)  LDD1596  [8]
 LDCM0393  CL122 HEK-293T C1549(1.06)  LDD1597  [8]
 LDCM0396  CL125 HEK-293T C1549(0.97); C752(0.90)  LDD1600  [8]
 LDCM0397  CL126 HEK-293T C1549(0.91)  LDD1601  [8]
 LDCM0400  CL13 HEK-293T C1549(1.13); C752(0.83)  LDD1604  [8]
 LDCM0401  CL14 HEK-293T C1549(0.88)  LDD1605  [8]
 LDCM0405  CL18 HEK-293T C643(1.02)  LDD1609  [8]
 LDCM0406  CL19 HEK-293T C643(1.08)  LDD1610  [8]
 LDCM0407  CL2 HEK-293T C1549(0.98)  LDD1611  [8]
 LDCM0410  CL22 HEK-293T C1549(1.12)  LDD1614  [8]
 LDCM0411  CL23 HEK-293T C1549(1.00)  LDD1615  [8]
 LDCM0412  CL24 HEK-293T C643(1.27)  LDD1616  [8]
 LDCM0413  CL25 HEK-293T C1549(0.91); C752(1.24)  LDD1617  [8]
 LDCM0414  CL26 HEK-293T C1549(0.90)  LDD1618  [8]
 LDCM0419  CL30 HEK-293T C643(1.11)  LDD1623  [8]
 LDCM0420  CL31 HEK-293T C643(1.19)  LDD1624  [8]
 LDCM0423  CL34 HEK-293T C1549(0.90)  LDD1627  [8]
 LDCM0424  CL35 HEK-293T C1549(1.08)  LDD1628  [8]
 LDCM0425  CL36 HEK-293T C643(0.99)  LDD1629  [8]
 LDCM0426  CL37 HEK-293T C1549(0.93); C752(1.25)  LDD1630  [8]
 LDCM0432  CL42 HEK-293T C643(1.01)  LDD1636  [8]
 LDCM0433  CL43 HEK-293T C643(1.03)  LDD1637  [8]
 LDCM0436  CL46 HEK-293T C1549(1.00)  LDD1640  [8]
 LDCM0437  CL47 HEK-293T C1549(1.06)  LDD1641  [8]
 LDCM0438  CL48 HEK-293T C643(1.05)  LDD1642  [8]
 LDCM0439  CL49 HEK-293T C1549(1.08); C752(0.85)  LDD1643  [8]
 LDCM0441  CL50 HEK-293T C1549(0.97)  LDD1645  [8]
 LDCM0445  CL54 HEK-293T C643(1.17)  LDD1648  [8]
 LDCM0446  CL55 HEK-293T C643(1.23)  LDD1649  [8]
 LDCM0449  CL58 HEK-293T C1549(0.91)  LDD1652  [8]
 LDCM0450  CL59 HEK-293T C1549(1.14)  LDD1653  [8]
 LDCM0451  CL6 HEK-293T C643(1.00)  LDD1654  [8]
 LDCM0452  CL60 HEK-293T C643(1.24)  LDD1655  [8]
 LDCM0453  CL61 HEK-293T C1549(0.95); C752(0.76)  LDD1656  [8]
 LDCM0454  CL62 HEK-293T C1549(1.00)  LDD1657  [8]
 LDCM0458  CL66 HEK-293T C643(0.96)  LDD1661  [8]
 LDCM0459  CL67 HEK-293T C643(1.10)  LDD1662  [8]
 LDCM0462  CL7 HEK-293T C643(1.10)  LDD1665  [8]
 LDCM0463  CL70 HEK-293T C1549(0.95)  LDD1666  [8]
 LDCM0464  CL71 HEK-293T C1549(1.19)  LDD1667  [8]
 LDCM0465  CL72 HEK-293T C643(1.11)  LDD1668  [8]
 LDCM0466  CL73 HEK-293T C1549(1.06); C752(0.93)  LDD1669  [8]
 LDCM0467  CL74 HEK-293T C1549(1.13)  LDD1670  [8]
 LDCM0471  CL78 HEK-293T C643(1.05)  LDD1674  [8]
 LDCM0472  CL79 HEK-293T C643(0.99)  LDD1675  [8]
 LDCM0476  CL82 HEK-293T C1549(0.99)  LDD1679  [8]
 LDCM0477  CL83 HEK-293T C1549(1.10)  LDD1680  [8]
 LDCM0478  CL84 HEK-293T C643(1.08)  LDD1681  [8]
 LDCM0479  CL85 HEK-293T C1549(1.00); C752(1.00)  LDD1682  [8]
 LDCM0480  CL86 HEK-293T C1549(0.92)  LDD1683  [8]
 LDCM0485  CL90 HEK-293T C643(1.40)  LDD1688  [8]
 LDCM0486  CL91 HEK-293T C643(1.10)  LDD1689  [8]
 LDCM0489  CL94 HEK-293T C1549(0.83)  LDD1692  [8]
 LDCM0490  CL95 HEK-293T C1549(1.11)  LDD1693  [8]
 LDCM0491  CL96 HEK-293T C643(0.92)  LDD1694  [8]
 LDCM0492  CL97 HEK-293T C1549(1.04); C752(0.80)  LDD1695  [8]
 LDCM0493  CL98 HEK-293T C1549(1.03)  LDD1696  [8]
 LDCM0427  Fragment51 HEK-293T C1549(0.88)  LDD1631  [8]
 LDCM0022  KB02 HEK-293T C1549(1.01)  LDD1492  [8]
 LDCM0023  KB03 HEK-293T C1549(1.17)  LDD1497  [8]
 LDCM0024  KB05 HMCB C1549(2.27)  LDD3312  [2]
 LDCM0021  THZ1 HCT 116 C1431(0.95); C1438(0.95)  LDD2173  [9]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
NADH dehydrogenase flavoprotein 2, mitochondrial (NDUFV2) Complex I 24 kDa subunit family P19404
Histone acetyltransferase KAT5 (KAT5) MYST (SAS/MOZ) family Q92993
Purine nucleoside phosphorylase (PNP) PNP/MTAP phosphorylase family P00491
Rho-related GTP-binding protein RhoH (RHOH) Rho family Q15669
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Amyloid-beta precursor protein (APP) APP family P05067
ADP-ribosylation factor-binding protein GGA1 (GGA1) GGA protein family Q9UJY5
Neuronal acetylcholine receptor subunit alpha-4 (CHRNA4) Ligand-gated ion channel family P43681
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
POU domain, class 6, transcription factor 2 (POU6F2) POU transcription factor family P78424
Cytokine and receptor
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Interleukin-6 (IL6) IL-6 superfamily P05231
Ciliary neurotrophic factor receptor subunit alpha (CNTFR) Type I cytokine receptor family P26992
Cytokine receptor-like factor 1 (CRLF1) Type I cytokine receptor family O75462
Interleukin-6 receptor subunit alpha (IL6R) Type I cytokine receptor family P08887
Other
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alpha-2-macroglobulin receptor-associated protein (LRPAP1) Alpha-2-MRAP family P30533
DNA damage-inducible transcript 4-like protein (DDIT4L) DDIT4 family Q96D03
Eukaryotic translation initiation factor 2 subunit 2 (EIF2S2) EIF-2-beta/eIF-5 family P20042
ADP-ribosylation factor-binding protein GGA2 (GGA2) GGA protein family Q9UJY4
Heat shock 70 kDa protein 12A (HSPA12A) Heat shock protein 70 family O43301
Chromobox protein homolog 1 (CBX1) . P83916

References

1 Tranylcypromine specificity for monoamine oxidase is limited by promiscuous protein labelling and lysosomal trapping. RSC Chem Biol. 2020 Aug 12;1(4):209-213. doi: 10.1039/d0cb00048e. eCollection 2020 Oct 1.
Mass spectrometry data entry: PXD018580
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
4 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
5 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
6 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
7 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
8 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
9 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.