Target ID	LDTP06490
Target Name	Vesicle-associated membrane protein 3 (VAMP3)
Gene Name	VAMP3
Gene ID	9341
Synonyms	SYB3; Vesicle-associated membrane protein 3; VAMP-3; Cellubrevin; CEB; Synaptobrevin-3
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQF ETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS
Target Bioclass	Transporter and channel
Family	Synaptobrevin family
Subcellular location	Early endosome membrane
Function	SNARE involved in vesicular transport from the late endosomes to the trans-Golgi network.
Uniprot ID	Q15836
Ensemble ID	ENST00000054666.11
HGNC ID	HGNC:12644

Probe name		Structure	Binding Site(Ratio)	Interaction ID	Ref
HDSF-alk  Probe Info			3.14	LDD0197	[1]
FBPP2  Probe Info			4.88	LDD0318	[2]
CHEMBL5175495  Probe Info			14.12	LDD0196	[3]
C-Sul  Probe Info			4.80	LDD0066	[4]
FBP2  Probe Info			4.37	LDD0317	[2]
YN-1  Probe Info			100.00	LDD0444	[5]
ONAyne  Probe Info			K35(5.35)	LDD0274	[6]
AZ-9  Probe Info			E61(1.07)	LDD2208	[7]
m-APA  Probe Info			10.15	LDD0403	[8]
Curcusone 37  Probe Info			4.69	LDD0188	[9]
Alkyne-RA190  Probe Info			2.79	LDD0302	[10]
ATP probe  Probe Info			K66(0.00); K68(0.00); K35(0.00)	LDD0199	[11]
NHS  Probe Info			K35(0.00); K66(0.00)	LDD0010	[12]
STPyne  Probe Info			N.A.	LDD0009	[12]
AOyne  Probe Info			9.40	LDD0443	[13]

Competitor ID	Name	Cell line	Binding Site(Ratio)	Interaction ID	Ref
LDCM0156	Aniline	NCI-H1299	10.15	LDD0403	[8]
LDCM0033	Curcusone1d	MCF-7	4.69	LDD0188	[9]
LDCM0131	RA190	SK-MEL-5	2.79	LDD0302	[10]

Protein name				Family	Uniprot ID
Catechol O-methyltransferase (COMT)				Cation-dependent O-methyltransferase family	P21964
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (EBP)				EBP family	Q15125
Very long chain fatty acid elongase 4 (ELOVL4)				ELO family	Q9GZR5
Probable glutathione peroxidase 8 (GPX8)				Glutathione peroxidase family	Q8TED1
Glutathione S-transferase 3, mitochondrial (MGST3)				MAPEG family	O14880
Microsomal glutathione S-transferase 2 (MGST2)				MAPEG family	Q99735
Prostaglandin E synthase (PTGES)				MAPEG family	O14684
Transmembrane protein with metallophosphoesterase domain (TMPPE)				LOC643853 family	Q6ZT21
Histone acetyltransferase KAT5 (KAT5)				MYST (SAS/MOZ) family	Q92993
ADP-ribosylation factor-like protein 13B (ARL13B)				Arf family	Q3SXY8
GTP-binding protein SAR1a (SAR1A)				SAR1 family	Q9NR31
Lysoplasmalogenase TMEM86B (TMEM86B)				TMEM86 family	Q8N661

Protein name				Family	Uniprot ID
14-3-3 protein gamma (YWHAG)				14-3-3 family	P61981
Hepatic sodium/bile acid cotransporter (SLC10A1)				Bile acid:sodium symporter (BASS) family	Q14973
Claudin-7 (CLDN7)				Claudin family	O95471
Novel acetylcholine receptor chaperone (TMEM35A)				DoxX family	Q53FP2
Transmembrane 4 L6 family member 19 (TM4SF19)				L6 tetraspanin family	Q96DZ7
Transmembrane 4 L6 family member 20 (TM4SF20)				L6 tetraspanin family	Q53R12
LHFPL tetraspan subfamily member 5 protein (LHFPL5)				LHFP family	Q8TAF8
Aquaporin-6 (AQP6)				MIP/aquaporin (TC 1.A.8) family	Q13520
Synaptosomal-associated protein 23 (SNAP23)				SNAP-25 family	O00161
Sodium channel regulatory subunit beta-3 (SCN3B)				Sodium channel auxiliary subunit SCN3B family	Q9NY72
Syntaxin-1A (STX1A)				Syntaxin family	Q16623
Syntaxin-4 (STX4)				Syntaxin family	Q12846
Potassium channel subfamily K member 5 (KCNK5)				Two pore domain potassium channel (TC 1.A.1.8) family	O95279
Barttin (BSND)				.	Q8WZ55
Thioredoxin-related transmembrane protein 2 (TMX2)				.	Q9Y320

Protein name				Family	Uniprot ID
B-cell antigen receptor complex-associated protein alpha chain (CD79A)				.	P11912
V-type immunoglobulin domain-containing suppressor of T-cell activation (VSIR)				.	Q9H7M9

Protein name				Family	Uniprot ID
Bcl-2-like protein 13 (BCL2L13)				Bcl-2 family	Q9BXK5
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3)				ERGIC family	Q9Y282
Membrane protein FAM174A (FAM174A)				FAM174 family	Q8TBP5
Protein FAM209A (FAM209A)				FAM209 family	Q5JX71
Protein FAM210B, mitochondrial (FAM210B)				FAM210 family	Q96KR6
RAB6-interacting golgin (GORAB)				GORAB family	Q5T7V8
Cytosolic iron-sulfur assembly component 2A (CIAO2A)				MIP18 family	Q9H5X1
Vascular endothelial growth factor D (VEGFD)				PDGF/VEGF growth factor family	O43915
Epithelial membrane protein 3 (EMP3)				PMP-22/EMP/MP20 family	P54852
Reticulophagy regulator 3 (RETREG3)				RETREG family	Q86VR2
Regulator of microtubule dynamics protein 3 (RMDN3)				RMDN family	Q96TC7
Synaptosomal-associated protein 29 (SNAP29)				SNAP-25 family	O95721
Bcl-2-interacting killer (BIK)				.	Q13323
C-type lectin domain family 14 member A (CLEC14A)				.	Q86T13
PDZK1-interacting protein 1 (PDZK1IP1)				.	Q13113
Pleckstrin homology domain-containing family O member 1 (PLEKHO1)				.	Q53GL0
Transmembrane protein 52B (TMEM52B)				.	Q4KMG9

1	Fatty Acyl Sulfonyl Fluoride as an Activity-Based Probe for Profiling Fatty Acid-Associated Proteins in Living Cells. Chembiochem. 2022 Feb 16;23(4):e202100628. doi: 10.1002/cbic.202100628. Epub 2021 Dec 30.
2	Tranylcypromine specificity for monoamine oxidase is limited by promiscuous protein labelling and lysosomal trapping. RSC Chem Biol. 2020 Aug 12;1(4):209-213. doi: 10.1039/d0cb00048e. eCollection 2020 Oct 1. Mass spectrometry data entry: PXD018580
3	Charting the Chemical Space of Acrylamide-Based Inhibitors of zDHHC20. ACS Med Chem Lett. 2022 Sep 26;13(10):1648-1654. doi: 10.1021/acsmedchemlett.2c00336. eCollection 2022 Oct 13.
4	Low-Toxicity Sulfonium-Based Probes for Cysteine-Specific Profiling in Live Cells. Anal Chem. 2022 Mar 15;94(10):4366-4372. doi: 10.1021/acs.analchem.1c05129. Epub 2022 Mar 4.
5	Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
6	A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10. Mass spectrometry data entry: PXD028270
7	2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
8	Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
9	Total Synthesis and Target Identification of the Curcusone Diterpenes. J Am Chem Soc. 2021 Mar 24;143(11):4379-4386. doi: 10.1021/jacs.1c00557. Epub 2021 Mar 11.
10	Physical and Functional Analysis of the Putative Rpn13 Inhibitor RA190. Cell Chem Biol. 2020 Nov 19;27(11):1371-1382.e6. doi: 10.1016/j.chembiol.2020.08.007. Epub 2020 Aug 27.
11	Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
12	A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21. Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
13	Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.