Details of the Target

General Information of Target

Target ID LDTP04752
Target Name Transcription factor SOX-10 (SOX10)
Gene Name SOX10
Gene ID 6663
Synonyms
Transcription factor SOX-10
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAEEQDLSEVELSPVGSEEPRCLSPGSAPSLGPDGGGGGSGLRASPGPGELGKVKKEQQD
GEADDDKFPVCIREAVSQVLSGYDWTLVPMPVRVNGASKSKPHVKRPMNAFMVWAQAARR
KLADQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRKN
GKAAQGEAECPGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT
PPTTPKTELQSGKADPKRDGRSMGEGGKPHIDFGNVDIGEISHEVMSNMETFDVAELDQY
LPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTET
AGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASG
LYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP
Target Bioclass
Transcription factor
Subcellular location
Cytoplasm
Function
Transcription factor that plays a central role in developing and mature glia. Specifically activates expression of myelin genes, during oligodendrocyte (OL) maturation, such as DUSP15 and MYRF, thereby playing a central role in oligodendrocyte maturation and CNS myelination. Once induced, MYRF cooperates with SOX10 to implement the myelination program. Transcriptional activator of MITF, acting synergistically with PAX3. Transcriptional activator of MBP, via binding to the gene promoter.
Uniprot ID
P56693
Ensemble ID
ENST00000360880.6
HGNC ID
HGNC:11190

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HCT15 SNV: p.D84N .
HT SNV: p.M289T .
HT3 SNV: p.G198D .
K562 SNV: p.L144M .
KMCH1 SNV: p.S374P .
LS180 SNV: p.D65N .
MFE319 SNV: p.E187K .
NALM6 SNV: p.P46L .
NCIH146 SNV: p.W455L .
TOV21G SNV: p.A195S .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C190(1.15); C71(3.19)  LDD3332  [1]
EA-probe
 Probe Info  		C71(2.07); C190(0.91)  LDD2210  [2]
HHS-482
 Probe Info  		Y171(0.86)  LDD0285  [3]
HHS-475
 Probe Info  		Y126(0.21); Y83(0.77); Y207(0.96); Y171(1.50)  LDD0264  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0175  Ethacrynic acid HeLa C71(2.07); C190(0.91)  LDD2210  [2]
 LDCM0116  HHS-0101 DM93 Y126(0.21); Y83(0.77); Y207(0.96); Y171(1.50)  LDD0264  [4]
 LDCM0117  HHS-0201 DM93 Y126(0.29); Y207(0.79); Y83(0.89); Y171(1.46)  LDD0265  [4]
 LDCM0118  HHS-0301 DM93 Y126(0.18); Y207(0.86); Y83(0.95); Y171(1.47)  LDD0266  [4]
 LDCM0119  HHS-0401 DM93 Y126(0.27); Y207(0.89); Y83(1.13); Y171(1.58)  LDD0267  [4]
 LDCM0120  HHS-0701 DM93 Y126(0.42); Y207(1.21); Y83(1.48); Y171(1.51)  LDD0268  [4]
 LDCM0123  JWB131 DM93 Y171(0.86)  LDD0285  [3]
 LDCM0124  JWB142 DM93 Y171(1.62); Y83(0.44)  LDD0286  [3]
 LDCM0125  JWB146 DM93 Y171(0.87); Y83(0.52)  LDD0287  [3]
 LDCM0126  JWB150 DM93 Y171(4.59); Y83(1.37)  LDD0288  [3]
 LDCM0127  JWB152 DM93 Y171(1.97); Y83(1.27)  LDD0289  [3]
 LDCM0128  JWB198 DM93 Y171(1.27); Y83(0.72)  LDD0290  [3]
 LDCM0129  JWB202 DM93 Y171(1.20); Y83(0.35)  LDD0291  [3]
 LDCM0130  JWB211 DM93 Y171(0.52); Y83(0.85)  LDD0292  [3]
 LDCM0022  KB02 A101D C71(2.34)  LDD2250  [1]
 LDCM0023  KB03 A101D C71(2.41)  LDD2667  [1]
 LDCM0024  KB05 MKN45 C190(1.15); C71(3.19)  LDD3332  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Histone acetyltransferase KAT5 (KAT5) MYST (SAS/MOZ) family Q92993
Protein kinase C alpha type (PRKCA) AGC Ser/Thr protein kinase family P17252
SUMO-conjugating enzyme UBC9 (UBE2I) Ubiquitin-conjugating enzyme family P63279
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
14-3-3 protein gamma (YWHAG) 14-3-3 family P61981
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cone-rod homeobox protein (CRX) Paired homeobox family O43186
Paired box protein Pax-3 (PAX3) Paired homeobox family P23760
POU domain, class 3, transcription factor 2 (POU3F2) POU transcription factor family P20265
POU domain, class 6, transcription factor 2 (POU6F2) POU transcription factor family P78424
Transcription factor SOX-10 (SOX10) . P56693
Other
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
N-myc-interactor (NMI) NMI family Q13287
Small ubiquitin-related modifier 1 (SUMO1) Ubiquitin family P63165
DAZ-associated protein 2 (DAZAP2) . Q15038
Melanoma-associated antigen D1 (MAGED1) . Q9Y5V3
Uncharacterized protein C10orf55 (C10orf55) . Q5SWW7

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Chemoproteomic Profiling Reveals Ethacrynic Acid Targets Adenine Nucleotide Translocases to Impair Mitochondrial Function. Mol Pharm. 2018 Jun 4;15(6):2413-2422. doi: 10.1021/acs.molpharmaceut.8b00250. Epub 2018 May 15.
3 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
4 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.