Details of the Target

General Information of Target

Target ID LDTP04668
Target Name Microfibrillar-associated protein 1 (MFAP1)
Gene Name MFAP1
Gene ID 4236
Synonyms
Microfibrillar-associated protein 1; Spliceosome B complex protein MFAP1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSVPSALMKQPPIQSTAGAVPVRNEKGEISMEKVKVKRYVSGKRPDYAPMESSDEEDEEF
QFIKKAKEQEAEPEEQEEDSSSDPRLRRLQNRISEDVEERLARHRKIVEPEVVGESDSEV
EGDAWRMEREDSSEEEEEEIDDEEIERRRGMMRQRAQERKNEEMEVMEVEDEGRSGEESE
SESEYEEYTDSEDEMEPRLKPVFIRKKDRVTVQEREAEALKQKELEQEAKRMAEERRKYT
LKIVEEETKKELEENKRSLAALDALNTDDENDEEEYEAWKVRELKRIKRDREDREALEKE
KAEIERMRNLTEEERRAELRANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDF
SAPTLEDHFNKTILPKVMQVKNFGRSGRTKYTHLVDQDTTSFDSAWGQESAQNTKFFKQK
AAGVRDVFERPSAKKRKTT
Target Bioclass
Other
Family
MFAP1 family
Subcellular location
Nucleus
Function Involved in pre-mRNA splicing as a component of the spliceosome.
Uniprot ID
P55081
Ensemble ID
ENST00000267812.4
HGNC ID
HGNC:7032

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
Probe 1
 Probe Info  		Y39(65.44)  LDD3495  [1]
Alkylaryl probe 3
 Probe Info  		20.00  LDD0382  [2]
Acrolein
 Probe Info  		H393(0.00); H368(0.00)  LDD0227  [3]
m-APA
 Probe Info  		N.A.  LDD2231  [4]
PAL-AfBPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C003
 Probe Info  		11.96  LDD1713  [5]
C355
 Probe Info  		29.04  LDD2016  [5]
C361
 Probe Info  		22.78  LDD2022  [5]
C391
 Probe Info  		13.64  LDD2050  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0109  NEM HeLa H393(0.00); H368(0.00)  LDD0227  [3]
 LDCM0099  Phenelzine HEK-293T 20.00  LDD0382  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ubiquitin thioesterase ZRANB1 (ZRANB1) Peptidase C64 family Q9UGI0
Dual specificity protein phosphatase CDC14B (CDC14B) Protein-tyrosine phosphatase family O60729
TNF receptor-associated factor 2 (TRAF2) TNF receptor-associated factor family Q12933
Kinesin-like protein KIFC3 (KIFC3) Kinesin family Q9BVG8
E3 ubiquitin-protein ligase TRIM41 (TRIM41) TRIM/RBCC family Q8WV44
Tripartite motif-containing protein 42 (TRIM42) TRIM/RBCC family Q8IWZ5
Germ cell-less protein-like 1 (GMCL1) . Q96IK5
Tripartite motif-containing protein 54 (TRIM54) . Q9BYV2
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
AP-2 complex subunit mu (AP2M1) Adaptor complexes medium subunit family Q96CW1
Leucine zipper putative tumor suppressor 1 (LZTS1) LZTS family Q9Y250
AP-4 complex accessory subunit Tepsin (TEPSIN) . Q96N21
Kelch-like protein 2 (KLHL2) . O95198
Transcription factor
Click To Hide/Show 21 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
G protein-coupled receptor associated sorting protein 3 (GPRASP3) GPRASP family Q6PI77
Endothelial zinc finger protein induced by tumor necrosis factor alpha (ZNF71) Krueppel C2H2-type zinc-finger protein family Q9NQZ8
Zinc finger and BTB domain-containing protein 14 (ZBTB14) Krueppel C2H2-type zinc-finger protein family O43829
Zinc finger protein 1 homolog (ZFP1) Krueppel C2H2-type zinc-finger protein family Q6P2D0
Zinc finger protein 134 (ZNF134) Krueppel C2H2-type zinc-finger protein family P52741
Zinc finger protein 212 (ZNF212) Krueppel C2H2-type zinc-finger protein family Q9UDV6
Zinc finger protein 398 (ZNF398) Krueppel C2H2-type zinc-finger protein family Q8TD17
Zinc finger protein 41 homolog (ZFP41) Krueppel C2H2-type zinc-finger protein family Q8N8Y5
Zinc finger protein 558 (ZNF558) Krueppel C2H2-type zinc-finger protein family Q96NG5
Zinc finger protein 620 (ZNF620) Krueppel C2H2-type zinc-finger protein family Q6ZNG0
Zinc finger protein 64 (ZFP64) Krueppel C2H2-type zinc-finger protein family Q9NTW7
Zinc finger protein 76 (ZNF76) Krueppel C2H2-type zinc-finger protein family P36508
Paired box protein Pax-6 (PAX6) Paired homeobox family P26367
THAP domain-containing protein 1 (THAP1) THAP1 family Q9NVV9
Deoxynucleotidyltransferase terminal-interacting protein 1 (DNTTIP1) . Q9H147
Golgin-45 (BLZF1) . Q9H2G9
Homeobox-containing protein 1 (HMBOX1) . Q6NT76
Oligodendrocyte transcription factor 3 (OLIG3) . Q7RTU3
Transcriptional adapter 2-alpha (TADA2A) . O75478
Zinc finger and BTB domain-containing protein 1 (ZBTB1) . Q9Y2K1
Zinc finger and BTB domain-containing protein 8A (ZBTB8A) . Q96BR9
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein Red (IK) RED family Q13123
Other
Click To Hide/Show 45 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Afadin- and alpha-actinin-binding protein (SSX2IP) ADIP family Q9Y2D8
Angiomotin-like protein 2 (AMOTL2) Angiomotin family Q9Y2J4
Centrosomal protein of 76 kDa (CEP76) CEP76 family Q8TAP6
Conserved oligomeric Golgi complex subunit 6 (COG6) COG6 family Q9Y2V7
Coilin (COIL) Coilin family P38432
Dynein regulatory complex subunit 4 (GAS8) DRC4 family O95995
Protein FAM9B (FAM9B) FAM9 family Q8IZU0
RNA-binding protein FXR2 (FXR2) FMR1 family P51116
G kinase-anchoring protein 1 (GKAP1) GKAP1 family Q5VSY0
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
Homer protein homolog 3 (HOMER3) Homer family Q9NSC5
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Lamin-B2 (LMNB2) Intermediate filament family Q03252
Protein LDOC1 (LDOC1) LDOC1 family O95751
Mitotic spindle assembly checkpoint protein MAD1 (MAD1L1) MAD1 family Q9Y6D9
Microtubule-associated tumor suppressor candidate 2 (MTUS2) MTUS1 family Q5JR59
Kinetochore protein NDC80 homolog (NDC80) NDC80/HEC1 family O14777
PIH1 domain-containing protein 1 (PIH1D1) PIH1 family Q9NWS0
PIN2/TERF1-interacting telomerase inhibitor 1 (PINX1) PINX1 family Q96BK5
Neuroguidin (NGDN) SAS10 family Q8NEJ9
Syntaxin-11 (STX11) Syntaxin family O75558
T-complex protein 10A homolog 1 (TCP10L) TCP10 family Q8TDR4
Tuftelin-interacting protein 11 (TFIP11) TFP11/STIP family Q9UBB9
Centrosomal protein CEP57L1 (CEP57L1) Translokin family Q8IYX8
Troponin I, slow skeletal muscle (TNNI1) Troponin I family P19237
Vacuolar protein sorting-associated protein 52 homolog (VPS52) VPS52 family Q8N1B4
TLE family member 5 (TLE5) WD repeat Groucho/TLE family Q08117
Caspase recruitment domain-containing protein 9 (CARD9) . Q9H257
Cell division cycle-associated 7-like protein (CDCA7L) . Q96GN5
Centrosomal protein of 55 kDa (CEP55) . Q53EZ4
Centrosomal protein of 70 kDa (CEP70) . Q8NHQ1
Coiled-coil domain-containing protein 102B (CCDC102B) . Q68D86
Coiled-coil domain-containing protein 57 (CCDC57) . Q2TAC2
GRIP1-associated protein 1 (GRIPAP1) . Q4V328
Heat shock factor 2-binding protein (HSF2BP) . O75031
KATNB1-like protein 1 (KATNBL1) . Q9H079
Microspherule protein 1 (MCRS1) . Q96EZ8
Mirror-image polydactyly gene 1 protein (MIPOL1) . Q8TD10
Pleckstrin homology domain-containing family F member 2 (PLEKHF2) . Q9H8W4
Polyhomeotic-like protein 2 (PHC2) . Q8IXK0
SH3 and cysteine-rich domain-containing protein 3 (STAC3) . Q96MF2
Smad nuclear-interacting protein 1 (SNIP1) . Q8TAD8
U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 1 (ZRSR2P1) . Q15695
U4/U6 small nuclear ribonucleoprotein Prp3 (PRPF3) . O43395

References

1 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
2 Hydrazines as versatile chemical biology probes and drug-discovery tools for cofactor-dependent enzymes. bioRxiv, 2020-06.
3 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
4 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
5 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587