Details of the Target
General Information of Target
Target ID | LDTP02494 | |||||
---|---|---|---|---|---|---|
Target Name | Histone H1.4 (H1-4) | |||||
Gene Name | H1-4 | |||||
Gene ID | 3008 | |||||
Synonyms |
H1F4; HIST1H1E; Histone H1.4; Histone H1b; Histone H1s-4 |
|||||
3D Structure | ||||||
Sequence |
MSETAPAAPAAPAPAEKTPVKKKARKSAGAAKRKASGPPVSELITKAVAASKERSGVSLA
ALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKA KKAGAAKAKKPAGAAKKPKKATGAATPKKSAKKTPKKAKKPAAAAGAKKAKSPKKAKAAK PKKAPKSPAKAKAVKPKAAKPKTAKPKAAKPKKAAAKKK |
|||||
Target Bioclass |
Other
|
|||||
Family |
Histone H1/H5 family
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Histone H1 protein binds to linker DNA between nucleosomes forming the macromolecular structure known as the chromatin fiber. Histones H1 are necessary for the condensation of nucleosome chains into higher-order structured fibers. Acts also as a regulator of individual gene transcription through chromatin remodeling, nucleosome spacing and DNA methylation.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
TH211 Probe Info |
![]() |
Y71(8.51) | LDD0260 | [1] | |
C-Sul Probe Info |
![]() |
5.13 | LDD0066 | [2] | |
TH216 Probe Info |
![]() |
Y71(7.71) | LDD0259 | [1] | |
YN-1 Probe Info |
![]() |
100.00 | LDD0444 | [3] | |
AZ-9 Probe Info |
![]() |
D72(0.95); E42(10.00); E74(10.00) | LDD2208 | [4] | |
ONAyne Probe Info |
![]() |
K160(0.00); K32(0.00); K148(0.00); K140(0.00) | LDD0273 | [5] | |
AMP probe Probe Info |
![]() |
K75(0.00); K90(0.00); K34(0.00) | LDD0200 | [6] | |
ATP probe Probe Info |
![]() |
K75(0.00); K90(0.00); K34(0.00); K64(0.00) | LDD0199 | [6] | |
CY-1 Probe Info |
![]() |
N.A. | LDD0246 | [7] | |
Alkyne tyramide Probe Info |
![]() |
K64(0.00); K90(0.00); K75(0.00); K110(0.00) | LDD0003 | [8] | |
2PCA Probe Info |
![]() |
K110(0.00); K85(0.00) | LDD0034 | [9] | |
aONE Probe Info |
![]() |
N.A. | LDD0002 | [8] | |
NHS Probe Info |
![]() |
K34(0.00); K75(0.00); K97(0.00); K46(0.00) | LDD0010 | [8] | |
SF Probe Info |
![]() |
K136(0.00); K32(0.00); K90(0.00); K119(0.00) | LDD0028 | [10] | |
STPyne Probe Info |
![]() |
K46(0.00); K106(0.00); K90(0.00); K64(0.00) | LDD0009 | [8] | |
1c-yne Probe Info |
![]() |
N.A. | LDD0228 | [11] | |
W1 Probe Info |
![]() |
K63(0.00); K64(0.00); S58(0.00); S89(0.00) | LDD0236 | [12] | |
HHS-475 Probe Info |
![]() |
Y71(0.86) | LDD2238 | [13] | |
HHS-482 Probe Info |
![]() |
Y71(0.91) | LDD2239 | [13] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
Diazir Probe Info |
![]() |
N.A. | LDD0011 | [8] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 (FTSJ3) | RNA methyltransferase RlmE family | Q8IY81 |
Transcription factor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Lethal(3)malignant brain tumor-like protein 1 (L3MBTL1) | . | Q9Y468 |
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
SH2/SH3 adapter protein NCK1 (NCK1) | . | P16333 |
References