Details of the Target

General Information of Target

Target ID LDTP13399
Target Name Drebrin-like protein (DBNL)
Gene Name DBNL
Gene ID 28988
Synonyms
CMAP; SH3P7; Drebrin-like protein; Cervical SH3P7; Cervical mucin-associated protein; Drebrin-F; HPK1-interacting protein of 55 kDa; HIP-55; SH3 domain-containing protein 7
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MTLSGGGSASDMSGQTVLTAEDVDIDVVGEGDDGLEEKDSDAGCDSPAGPPELRLDEADE
VPPAAPHHGQPQPPHQQPLTLPKEAAGAGAGPGGDVGAPEADGCKGGVGGEEGGASGGGP
GAGSGSAGGLAPSKPKNSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYRE
KFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFKRH
QQEHLREQTALMMQSFGAYSLAAAAGAAGPYGRPYGLHPAAAAGAYSHPAAAAAAAAAAA
LQYPYALPPVAPVLPPAVPLLPSGELGRKAAAFGSQLGPGLQLQLNSLGAAAAAAGTAGA
AGTTASLIKSEPSARPSFSIENIIGGGPAAPGGSAVGAGVAGGTGGSGGGSTAQSFLRPP
GTVQSAALMATHQPLSLSRTTATIAPILSVPLSGQFLQPAASAAAAAAAAAQAKWPAQ
Target Bioclass
Other
Family
ABP1 family
Subcellular location
Cytoplasm, cytoskeleton
Function
Adapter protein that binds F-actin and DNM1, and thereby plays a role in receptor-mediated endocytosis. Plays a role in the reorganization of the actin cytoskeleton, formation of cell projections, such as neurites, in neuron morphogenesis and synapse formation via its interaction with WASL and COBL. Does not bind G-actin and promote actin polymerization by itself. Required for the formation of organized podosome rosettes. May act as a common effector of antigen receptor-signaling pathways in leukocytes. Acts as a key component of the immunological synapse that regulates T-cell activation by bridging TCRs and the actin cytoskeleton to gene activation and endocytic processes.
Uniprot ID
Q9UJU6
Ensemble ID
ENST00000440166.5
HGNC ID
HGNC:2696

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HEC1B SNV: p.K61N .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 27 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
TH211
 Probe Info  		Y140(20.00)  LDD0260  [2]
ONAyne
 Probe Info  		K144(1.11)  LDD0274  [3]
STPyne
 Probe Info  		K144(5.75); K164(10.00); K172(3.31); K176(5.74)  LDD0277  [3]
AZ-9
 Probe Info  		E55(1.12); E242(10.00); E238(10.00)  LDD2208  [4]
Probe 1
 Probe Info  		Y16(28.34); Y140(17.51)  LDD3495  [5]
DBIA
 Probe Info  		C67(1.77)  LDD3310  [6]
HHS-482
 Probe Info  		Y140(0.98); Y162(0.73); Y224(0.48)  LDD0285  [7]
HHS-475
 Probe Info  		Y140(0.87); Y162(0.87); Y224(1.24)  LDD0264  [8]
HHS-465
 Probe Info  		Y140(10.00); Y224(10.00)  LDD2237  [9]
5E-2FA
 Probe Info  		H143(0.00); H256(0.00); H296(0.00)  LDD2235  [10]
ATP probe
 Probe Info  		K70(0.00); K144(0.00)  LDD0199  [11]
4-Iodoacetamidophenylacetylene
 Probe Info  		C127(0.00); C97(0.00); C67(0.00)  LDD0038  [12]
IA-alkyne
 Probe Info  		N.A.  LDD0032  [13]
Lodoacetamide azide
 Probe Info  		C127(0.00); C97(0.00); C67(0.00)  LDD0037  [12]
IPM
 Probe Info  		N.A.  LDD0025  [14]
NAIA_4
 Probe Info  		N.A.  LDD2226  [15]
SF
 Probe Info  		K144(0.00); Y224(0.00); Y140(0.00)  LDD0028  [16]
TFBX
 Probe Info  		N.A.  LDD0148  [14]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [17]
Ox-W18
 Probe Info  		N.A.  LDD2175  [18]
1c-yne
 Probe Info  		K288(0.00); K164(0.00); K23(0.00)  LDD0228  [19]
Acrolein
 Probe Info  		C127(0.00); C97(0.00)  LDD0217  [20]
Methacrolein
 Probe Info  		N.A.  LDD0218  [20]
W1
 Probe Info  		C127(0.00); C67(0.00)  LDD0236  [21]
AOyne
 Probe Info  		8.40  LDD0443  [22]
NAIA_5
 Probe Info  		C127(0.00); C97(0.00); C67(0.00)  LDD2223  [15]
PAL-AfBPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
FFF probe13
 Probe Info  		13.46  LDD0475  [23]
VE-P
 Probe Info  		N.A.  LDD0396  [24]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0025  4SU-RNA HEK-293T C97(4.07)  LDD0371  [25]
 LDCM0156  Aniline NCI-H1299 13.03  LDD0403  [1]
 LDCM0108  Chloroacetamide HeLa C127(0.00); H256(0.00)  LDD0222  [20]
 LDCM0632  CL-Sc Hep-G2 C97(1.60); C127(0.87)  LDD2227  [15]
 LDCM0634  CY-0357 Hep-G2 C127(1.17)  LDD2228  [15]
 LDCM0625  F8 Ramos C97(0.85)  LDD2187  [26]
 LDCM0573  Fragment11 Ramos C127(1.20); C97(0.51)  LDD2190  [26]
 LDCM0576  Fragment14 Ramos C97(0.69)  LDD2193  [26]
 LDCM0586  Fragment28 Ramos C127(0.30)  LDD2198  [26]
 LDCM0566  Fragment4 Ramos C127(0.67); C97(0.90)  LDD2184  [26]
 LDCM0569  Fragment7 Ramos C127(0.36); C97(0.82)  LDD2186  [26]
 LDCM0116  HHS-0101 DM93 Y140(0.87); Y162(0.87); Y224(1.24)  LDD0264  [8]
 LDCM0117  HHS-0201 DM93 Y140(0.72); Y224(1.01); Y162(1.17)  LDD0265  [8]
 LDCM0118  HHS-0301 DM93 Y140(0.68); Y224(1.13); Y162(1.34)  LDD0266  [8]
 LDCM0119  HHS-0401 DM93 Y140(0.71); Y162(1.00); Y224(1.17)  LDD0267  [8]
 LDCM0120  HHS-0701 DM93 Y140(0.72); Y224(1.05); Y162(1.17)  LDD0268  [8]
 LDCM0123  JWB131 DM93 Y140(0.98); Y162(0.73); Y224(0.48)  LDD0285  [7]
 LDCM0124  JWB142 DM93 Y140(0.83); Y162(0.71); Y224(0.90)  LDD0286  [7]
 LDCM0125  JWB146 DM93 Y140(0.92); Y162(0.97); Y224(0.99)  LDD0287  [7]
 LDCM0126  JWB150 DM93 Y140(3.02); Y162(4.03); Y224(2.88)  LDD0288  [7]
 LDCM0127  JWB152 DM93 Y140(1.92); Y162(1.95); Y224(1.93)  LDD0289  [7]
 LDCM0128  JWB198 DM93 Y140(1.26); Y162(1.37); Y224(1.44)  LDD0290  [7]
 LDCM0129  JWB202 DM93 Y140(0.66); Y162(0.37); Y224(0.95)  LDD0291  [7]
 LDCM0130  JWB211 DM93 Y140(1.10); Y162(1.12); Y224(1.03)  LDD0292  [7]
 LDCM0022  KB02 Ramos C127(0.25); C97(0.51)  LDD2182  [26]
 LDCM0023  KB03 Ramos C127(0.41); C97(0.76)  LDD2183  [26]
 LDCM0024  KB05 COLO792 C67(1.77)  LDD3310  [6]
 LDCM0109  NEM HeLa N.A.  LDD0225  [20]
 LDCM0627  NUDT7-COV-1 HEK-293T C127(3.30)  LDD2206  [27]
 LDCM0628  OTUB2-COV-1 HEK-293T C127(0.64)  LDD2207  [27]
 LDCM0131  RA190 MM1.R C97(1.48); C127(1.02)  LDD0304  [28]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Fibroblast growth factor receptor 3 (FGFR3) Tyr protein kinase family P22607
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Glutamate receptor ionotropic, NMDA 2C (GRIN2C) Glutamate-gated ion channel family Q14957
Huntingtin (HTT) Huntingtin family P42858
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Krueppel-like factor 11 (KLF11) Sp1 C2H2-type zinc-finger protein family O14901
Other
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Axonemal dynein light intermediate polypeptide 1 (DNALI1) Inner dynein arm light chain family O14645
Gelsolin (GSN) Villin/gelsolin family P06396
Adrenocortical dysplasia protein homolog (ACD) . Q96AP0
SH2 domain-containing protein 4A (SH2D4A) . Q9H788
SH3 domain-binding protein 2 (SH3BP2) . P78314
Ubiquilin-1 (UBQLN1) . Q9UMX0

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
3 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
4 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
5 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
6 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
7 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
8 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
9 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
10 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
11 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
12 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
13 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
14 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
15 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
16 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
17 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
18 Oxidative cyclization reagents reveal tryptophan cation- interactions. Nature. 2024 Mar;627(8004):680-687. doi: 10.1038/s41586-024-07140-6. Epub 2024 Mar 6.
Mass spectrometry data entry: PXD001377 , PXD005252
19 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
20 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
21 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
22 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
23 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.
24 Pharmacological Targeting of Vacuolar H(+)-ATPase via Subunit V1G Combats Multidrug-Resistant Cancer. Cell Chem Biol. 2020 Nov 19;27(11):1359-1370.e8. doi: 10.1016/j.chembiol.2020.06.011. Epub 2020 Jul 9.
25 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
26 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
27 Rapid Covalent-Probe Discovery by Electrophile-Fragment Screening. J Am Chem Soc. 2019 Jun 5;141(22):8951-8968. doi: 10.1021/jacs.9b02822. Epub 2019 May 22.
28 Physical and Functional Analysis of the Putative Rpn13 Inhibitor RA190. Cell Chem Biol. 2020 Nov 19;27(11):1371-1382.e6. doi: 10.1016/j.chembiol.2020.08.007. Epub 2020 Aug 27.