Details of the Target
General Information of Target
| Target ID | LDTP13399 | |||||
|---|---|---|---|---|---|---|
| Target Name | Drebrin-like protein (DBNL) | |||||
| Gene Name | DBNL | |||||
| Gene ID | 28988 | |||||
| Synonyms |
CMAP; SH3P7; Drebrin-like protein; Cervical SH3P7; Cervical mucin-associated protein; Drebrin-F; HPK1-interacting protein of 55 kDa; HIP-55; SH3 domain-containing protein 7 |
|||||
| 3D Structure | ||||||
| Sequence |
MTLSGGGSASDMSGQTVLTAEDVDIDVVGEGDDGLEEKDSDAGCDSPAGPPELRLDEADE
VPPAAPHHGQPQPPHQQPLTLPKEAAGAGAGPGGDVGAPEADGCKGGVGGEEGGASGGGP GAGSGSAGGLAPSKPKNSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYRE KFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFKRH QQEHLREQTALMMQSFGAYSLAAAAGAAGPYGRPYGLHPAAAAGAYSHPAAAAAAAAAAA LQYPYALPPVAPVLPPAVPLLPSGELGRKAAAFGSQLGPGLQLQLNSLGAAAAAAGTAGA AGTTASLIKSEPSARPSFSIENIIGGGPAAPGGSAVGAGVAGGTGGSGGGSTAQSFLRPP GTVQSAALMATHQPLSLSRTTATIAPILSVPLSGQFLQPAASAAAAAAAAAQAKWPAQ |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
ABP1 family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton
|
|||||
| Function |
Adapter protein that binds F-actin and DNM1, and thereby plays a role in receptor-mediated endocytosis. Plays a role in the reorganization of the actin cytoskeleton, formation of cell projections, such as neurites, in neuron morphogenesis and synapse formation via its interaction with WASL and COBL. Does not bind G-actin and promote actin polymerization by itself. Required for the formation of organized podosome rosettes. May act as a common effector of antigen receptor-signaling pathways in leukocytes. Acts as a key component of the immunological synapse that regulates T-cell activation by bridging TCRs and the actin cytoskeleton to gene activation and endocytic processes.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
![]() |
15.00 | LDD0402 | [1] | |
|
TH211 Probe Info |
![]() |
Y140(20.00) | LDD0260 | [2] | |
|
ONAyne Probe Info |
![]() |
K144(1.11) | LDD0274 | [3] | |
|
STPyne Probe Info |
![]() |
K144(5.75); K164(10.00); K172(3.31); K176(5.74) | LDD0277 | [3] | |
|
AZ-9 Probe Info |
![]() |
E55(1.12); E242(10.00); E238(10.00) | LDD2208 | [4] | |
|
Probe 1 Probe Info |
![]() |
Y16(28.34); Y140(17.51) | LDD3495 | [5] | |
|
DBIA Probe Info |
![]() |
C67(1.77) | LDD3310 | [6] | |
|
HHS-482 Probe Info |
![]() |
Y140(0.98); Y162(0.73); Y224(0.48) | LDD0285 | [7] | |
|
HHS-475 Probe Info |
![]() |
Y140(0.87); Y162(0.87); Y224(1.24) | LDD0264 | [8] | |
|
HHS-465 Probe Info |
![]() |
Y140(10.00); Y224(10.00) | LDD2237 | [9] | |
|
5E-2FA Probe Info |
![]() |
H143(0.00); H256(0.00); H296(0.00) | LDD2235 | [10] | |
|
ATP probe Probe Info |
![]() |
K70(0.00); K144(0.00) | LDD0199 | [11] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
C127(0.00); C97(0.00); C67(0.00) | LDD0038 | [12] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0032 | [13] | |
|
Lodoacetamide azide Probe Info |
![]() |
C127(0.00); C97(0.00); C67(0.00) | LDD0037 | [12] | |
|
IPM Probe Info |
![]() |
N.A. | LDD0025 | [14] | |
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [15] | |
|
SF Probe Info |
![]() |
K144(0.00); Y224(0.00); Y140(0.00) | LDD0028 | [16] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [14] | |
|
Phosphinate-6 Probe Info |
![]() |
N.A. | LDD0018 | [17] | |
|
Ox-W18 Probe Info |
![]() |
N.A. | LDD2175 | [18] | |
|
1c-yne Probe Info |
![]() |
K288(0.00); K164(0.00); K23(0.00) | LDD0228 | [19] | |
|
Acrolein Probe Info |
![]() |
C127(0.00); C97(0.00) | LDD0217 | [20] | |
|
Methacrolein Probe Info |
![]() |
N.A. | LDD0218 | [20] | |
|
W1 Probe Info |
![]() |
C127(0.00); C67(0.00) | LDD0236 | [21] | |
|
AOyne Probe Info |
![]() |
8.40 | LDD0443 | [22] | |
|
NAIA_5 Probe Info |
![]() |
C127(0.00); C97(0.00); C67(0.00) | LDD2223 | [15] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
FFF probe13 Probe Info |
![]() |
13.46 | LDD0475 | [23] | |
|
VE-P Probe Info |
![]() |
N.A. | LDD0396 | [24] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0025 | 4SU-RNA | HEK-293T | C97(4.07) | LDD0371 | [25] |
| LDCM0156 | Aniline | NCI-H1299 | 13.03 | LDD0403 | [1] |
| LDCM0108 | Chloroacetamide | HeLa | C127(0.00); H256(0.00) | LDD0222 | [20] |
| LDCM0632 | CL-Sc | Hep-G2 | C97(1.60); C127(0.87) | LDD2227 | [15] |
| LDCM0634 | CY-0357 | Hep-G2 | C127(1.17) | LDD2228 | [15] |
| LDCM0625 | F8 | Ramos | C97(0.85) | LDD2187 | [26] |
| LDCM0573 | Fragment11 | Ramos | C127(1.20); C97(0.51) | LDD2190 | [26] |
| LDCM0576 | Fragment14 | Ramos | C97(0.69) | LDD2193 | [26] |
| LDCM0586 | Fragment28 | Ramos | C127(0.30) | LDD2198 | [26] |
| LDCM0566 | Fragment4 | Ramos | C127(0.67); C97(0.90) | LDD2184 | [26] |
| LDCM0569 | Fragment7 | Ramos | C127(0.36); C97(0.82) | LDD2186 | [26] |
| LDCM0116 | HHS-0101 | DM93 | Y140(0.87); Y162(0.87); Y224(1.24) | LDD0264 | [8] |
| LDCM0117 | HHS-0201 | DM93 | Y140(0.72); Y224(1.01); Y162(1.17) | LDD0265 | [8] |
| LDCM0118 | HHS-0301 | DM93 | Y140(0.68); Y224(1.13); Y162(1.34) | LDD0266 | [8] |
| LDCM0119 | HHS-0401 | DM93 | Y140(0.71); Y162(1.00); Y224(1.17) | LDD0267 | [8] |
| LDCM0120 | HHS-0701 | DM93 | Y140(0.72); Y224(1.05); Y162(1.17) | LDD0268 | [8] |
| LDCM0123 | JWB131 | DM93 | Y140(0.98); Y162(0.73); Y224(0.48) | LDD0285 | [7] |
| LDCM0124 | JWB142 | DM93 | Y140(0.83); Y162(0.71); Y224(0.90) | LDD0286 | [7] |
| LDCM0125 | JWB146 | DM93 | Y140(0.92); Y162(0.97); Y224(0.99) | LDD0287 | [7] |
| LDCM0126 | JWB150 | DM93 | Y140(3.02); Y162(4.03); Y224(2.88) | LDD0288 | [7] |
| LDCM0127 | JWB152 | DM93 | Y140(1.92); Y162(1.95); Y224(1.93) | LDD0289 | [7] |
| LDCM0128 | JWB198 | DM93 | Y140(1.26); Y162(1.37); Y224(1.44) | LDD0290 | [7] |
| LDCM0129 | JWB202 | DM93 | Y140(0.66); Y162(0.37); Y224(0.95) | LDD0291 | [7] |
| LDCM0130 | JWB211 | DM93 | Y140(1.10); Y162(1.12); Y224(1.03) | LDD0292 | [7] |
| LDCM0022 | KB02 | Ramos | C127(0.25); C97(0.51) | LDD2182 | [26] |
| LDCM0023 | KB03 | Ramos | C127(0.41); C97(0.76) | LDD2183 | [26] |
| LDCM0024 | KB05 | COLO792 | C67(1.77) | LDD3310 | [6] |
| LDCM0109 | NEM | HeLa | N.A. | LDD0225 | [20] |
| LDCM0627 | NUDT7-COV-1 | HEK-293T | C127(3.30) | LDD2206 | [27] |
| LDCM0628 | OTUB2-COV-1 | HEK-293T | C127(0.64) | LDD2207 | [27] |
| LDCM0131 | RA190 | MM1.R | C97(1.48); C127(1.02) | LDD0304 | [28] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Fibroblast growth factor receptor 3 (FGFR3) | Tyr protein kinase family | P22607 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Glutamate receptor ionotropic, NMDA 2C (GRIN2C) | Glutamate-gated ion channel family | Q14957 | |||
| Huntingtin (HTT) | Huntingtin family | P42858 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Krueppel-like factor 11 (KLF11) | Sp1 C2H2-type zinc-finger protein family | O14901 | |||
Other
References





























