Details of the Target

General Information of Target

Target ID LDTP07632
Target Name Type-1 angiotensin II receptor-associated protein (AGTRAP)
Gene Name AGTRAP
Gene ID 57085
Synonyms
ATRAP; Type-1 angiotensin II receptor-associated protein; AT1 receptor-associated protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MELPAVNLKVILLGHWLLTTWGCIVFSGSYAWANFTILALGVWAVAQRDSIDAISMFLGG
LLATIFLDIVHISIFYPRVSLTDTGRFGVGMAILSLLLKPLSCCFVYHMYRERGGELLVH
TGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDARGY
Target Bioclass
Other
Subcellular location
Endoplasmic reticulum membrane
Function
Appears to be a negative regulator of type-1 angiotensin II receptor-mediated signaling by regulating receptor internalization as well as mechanism of receptor desensitization such as phosphorylation. Induces also a decrease in cell proliferation and angiotensin II-stimulated transcriptional activity.
Uniprot ID
Q6RW13
Ensemble ID
ENST00000314340.10
HGNC ID
HGNC:13539

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
SW837 SNV: p.P100T .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
CY-1
 Probe Info  		100.00  LDD0243  [1]
CY4
 Probe Info  		100.00  LDD0244  [1]
HPAP
 Probe Info  		3.04  LDD0062  [2]
Acrolein
 Probe Info  		N.A.  LDD0227  [3]
PAL-AfBPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C040
 Probe Info  		8.22  LDD1740  [4]
C362
 Probe Info  		29.86  LDD2023  [4]
C431
 Probe Info  		13.93  LDD2086  [4]
OEA-DA
 Probe Info  		8.07  LDD0046  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0109  NEM HeLa N.A.  LDD0227  [3]
 LDCM0014  Panhematin HEK-293T 3.04  LDD0062  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 36 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Pyruvate dehydrogenase protein X component, mitochondrial (PDHX) 2-oxoacid dehydrogenase family O00330
Maspardin (SPG21) AB hydrolase superfamily Q9NZD8
Medium-chain acyl-CoA ligase ACSF2, mitochondrial (ACSF2) ATP-dependent AMP-binding enzyme family Q96CM8
rRNA methyltransferase 1, mitochondrial (MRM1) RNA methyltransferase TrmH family Q6IN84
Tyrosine--tRNA ligase, mitochondrial (YARS2) Class-I aminoacyl-tRNA synthetase family Q9Y2Z4
Histidine--tRNA ligase, mitochondrial (HARS2) Class-II aminoacyl-tRNA synthetase family P49590
Phenylalanine--tRNA ligase, mitochondrial (FARS2) Class-II aminoacyl-tRNA synthetase family O95363
Peptidyl-prolyl cis-trans isomerase F, mitochondrial (PPIF) Cyclophilin-type PPIase family P30405
Choline-phosphate cytidylyltransferase A (PCYT1A) Cytidylyltransferase family P49585
ATP-dependent RNA helicase DDX55 (DDX55) DEAD box helicase family Q8NHQ9
ATP synthase subunit epsilon, mitochondrial (ATP5F1E) Eukaryotic ATPase epsilon family P56381
FAST kinase domain-containing protein 3, mitochondrial (FASTKD3) FAST kinase family Q14CZ7
FAST kinase domain-containing protein 4 (TBRG4) FAST kinase family Q969Z0
NADH-cytochrome b5 reductase 3 (CYB5R3) Flavoprotein pyridine nucleotide cytochrome reductase family P00387
Delta-1-pyrroline-5-carboxylate synthase (ALDH18A1) Glutamate 5-kinase family; Gamma-glutamyl phosphate reductase family P54886
Probable glutathione peroxidase 8 (GPX8) Glutathione peroxidase family Q8TED1
Glutamate decarboxylase 1 (GAD1) Group II decarboxylase family Q99259
Glutamate decarboxylase 2 (GAD2) Group II decarboxylase family Q05329
3-hydroxyisobutyrate dehydrogenase, mitochondrial (HIBADH) HIBADH-related family P31937
Glutathione S-transferase 3, mitochondrial (MGST3) MAPEG family O14880
Transmembrane protein with metallophosphoesterase domain (TMPPE) LOC643853 family Q6ZT21
Methylmalonyl-CoA epimerase, mitochondrial (MCEE) Methylmalonyl-CoA epimerase family Q96PE7
MYG1 exonuclease (MYG1) MYG1 family Q9HB07
Protein NDRG4 (NDRG4) NDRG family Q9ULP0
Peroxynitrite isomerase THAP4 (THAP4) Nitrobindin family Q8WY91
Sentrin-specific protease 2 (SENP2) Peptidase C48 family Q9HC62
Chymotrypsin-like elastase family member 3A (CELA3A) Peptidase S1 family P09093
Atypical kinase COQ8A, mitochondrial (COQ8A) ADCK protein kinase family Q8NI60
Tyrosine-protein phosphatase non-receptor type 9 (PTPN9) Protein-tyrosine phosphatase family P43378
Pyridoxine-5'-phosphate oxidase (PNPO) Pyridoxamine 5'-phosphate oxidase family Q9NVS9
17-beta-hydroxysteroid dehydrogenase 13 (HSD17B13) Short-chain dehydrogenases/reductases (SDR) family Q7Z5P4
Ras-related protein Rab-30 (RAB30) Rab family Q15771
Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial (SUCLA2) Succinate/malate CoA ligase beta subunit family Q9P2R7
Thioredoxin, mitochondrial (TXN2) Thioredoxin family Q99757
Tubulin alpha-1B chain (TUBA1B) Tubulin family P68363
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
Transporter and channel
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Monocyte to macrophage differentiation factor (MMD) ADIPOR family Q15546
Solute carrier family 7 member 14 (SLC7A14) Cationic amino acid transporter (CAT) (TC 2.A.3.3) family Q8TBB6
Endophilin-B1 (SH3GLB1) Endophilin family Q9Y371
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
Cytoplasmic phosphatidylinositol transfer protein 1 (PITPNC1) PtdIns transfer protein family Q9UKF7
Sorting nexin-1 (SNX1) Sorting nexin family Q13596
Syntaxin-1A (STX1A) Syntaxin family Q16623
Potassium channel subfamily K member 5 (KCNK5) Two pore domain potassium channel (TC 1.A.1.8) family O95279
Leucine-rich repeat-containing protein 59 (LRRC59) . Q96AG4
Transmembrane protein 139 (TMEM139) . Q8IV31
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
High mobility group protein B1 (HMGB1) HMGB family P09429
Heat shock transcription factor, X-linked (HSFX1; HSFX2) HSF family Q9UBD0
Nuclear transcription factor Y subunit beta (NFYB) NFYB/HAP3 subunit family P25208
DnaJ homolog subfamily C member 1 (DNAJC1) . Q96KC8
Transcription factor A, mitochondrial (TFAM) . Q00059
GPCR
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Free fatty acid receptor 2 (FFAR2) G-protein coupled receptor 1 family O15552
Probable G-protein coupled receptor 152 (GPR152) G-protein coupled receptor 1 family Q8TDT2
Immunoglobulin
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Killer cell immunoglobulin-like receptor 2DL3 (KIR2DL3) Immunoglobulin superfamily P43628
Killer cell immunoglobulin-like receptor 3DL3 (KIR3DL3) Immunoglobulin superfamily Q8N743
B-cell antigen receptor complex-associated protein alpha chain (CD79A) . P11912
CD160 antigen (CD160) . O95971
Leucine-rich repeat-containing protein 4C (LRRC4C) . Q9HCJ2
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Interleukin-7 receptor subunit alpha (IL7R) Type I cytokine receptor family P16871
Other
Click To Hide/Show 58 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
AP-3 complex subunit mu-1 (AP3M1) Adaptor complexes medium subunit family Q9Y2T2
Apolipoprotein A-IV (APOA4) Apolipoprotein A1/A4/E family P06727
Gamma-aminobutyric acid receptor-associated protein-like 2 (GABARAPL2) ATG8 family P60520
Bcl-2-like protein 13 (BCL2L13) Bcl-2 family Q9BXK5
BPI fold-containing family A member 2 (BPIFA2) Plunc family Q96DR5
Electron transfer flavoprotein regulatory factor 1 (ETFRF1) Complex I LYR family Q6IPR1
Complexin-4 (CPLX4) Complexin/synaphin family Q7Z7G2
Cytochrome b-245 chaperone 1 (CYBC1) CYBC1 family Q9BQA9
DET1- and DDB1-associated protein 1 (DDA1) DDA1 family Q9BW61
Proteasome adapter and scaffold protein ECM29 (ECPAS) ECM29 family Q5VYK3
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Protein NOXP20 (FAM114A1) FAM114 family Q8IWE2
Protein FAM209A (FAM209A) FAM209 family Q5JX71
FHF complex subunit HOOK-interacting protein 1B (FHIP1B) FHIP family Q8N612
Heat shock 70 kDa protein 4 (HSPA4) Heat shock protein 70 family P34932
Histone H4-like protein type G (H4C7) Histone H4 family Q99525
Heat shock factor-binding protein 1-like protein 1 (HSBP1L1) HSBP1 family C9JCN9
Iron-sulfur cluster co-chaperone protein HscB (HSCB) HscB family Q8IWL3
Mitochondrial dynamics protein MID49 (MIEF2) MID49/MID51 family Q96C03
Transcription termination factor 3, mitochondrial (MTERF3) MTERF family Q96E29
Iron-sulfur cluster assembly enzyme ISCU (ISCU) NifU family Q9H1K1
NFU1 iron-sulfur cluster scaffold homolog, mitochondrial (NFU1) NifU family Q9UMS0
Protein NKG7 (NKG7) PMP-22/EMP/MP20 family Q16617
Pre-mRNA-splicing factor 18 (PRPF18) PRP18 family Q99633
Putative ribosome-binding factor A, mitochondrial (RBFA) RbfA family Q8N0V3
Reticulophagy regulator 3 (RETREG3) RETREG family Q86VR2
Regulator of microtubule dynamics protein 2 (RMDN2) RMDN family Q96LZ7
Ribosome-recycling factor, mitochondrial (MRRF) RRF family Q96E11
Mitochondrial dynamics protein MIEF1 (MIEF1) SMCR7 family Q9NQG6
Nonsense-mediated mRNA decay factor SMG9 (SMG9) SMG9 family Q9H0W8
Protein SSX3 (SSX3) SSX family Q99909
Protein SSX5 (SSX5) SSX family O60225
Synaptotagmin-16 (SYT16) Synaptotagmin family Q17RD7
Transcription elongation factor A N-terminal and central domain-containing protein 2 (TCEANC2) TCEANC2 family Q96MN5
General transcription factor IIH subunit 1 (GTF2H1) TFB1 family P32780
General transcription factor 3C polypeptide 1 (GTF3C1) TFIIIC subunit 1 family Q12789
Transcription elongation factor A protein 2 (TCEA2) TFS-II family Q15560
Glial cell line-derived neurotrophic factor (GDNF) TGF-beta family P39905
Tumor protein D55 (TPD52L3) TPD52 family Q96J77
Large ribosomal subunit protein uL11m (MRPL11) Universal ribosomal protein uL11 family Q9Y3B7
Alpha-tocopherol transfer protein (TTPA) . P49638
Ankyrin repeat and SAM domain-containing protein 6 (ANKS6) . Q68DC2
Arfaptin-2 (ARFIP2) . P53365
Calpain small subunit 1 (CAPNS1) . P04632
Coiled-coil domain-containing protein 70 (CCDC70) . Q6NSX1
Cysteine-rich C-terminal protein 1 (CRCT1) . Q9UGL9
Diablo IAP-binding mitochondrial protein (DIABLO) . Q9NR28
Fetal and adult testis-expressed transcript protein (FATE1) . Q969F0
Fibronectin type III domain-containing protein 9 (FNDC9) . Q8TBE3
NADH dehydrogenase 1 alpha subcomplex assembly factor 3 (NDUFAF3) . Q9BU61
Phosphatidylcholine transfer protein (PCTP) . Q9UKL6
Polymerase delta-interacting protein 2 (POLDIP2) . Q9Y2S7
Protein PIMREG (PIMREG) . Q9BSJ6
Rhombotin-2 (LMO2) . P25791
SCAN domain-containing protein 1 (SCAND1) . P57086
StAR-related lipid transfer protein 4 (STARD4) . Q96DR4
Steroidogenic acute regulatory protein, mitochondrial (STAR) . P49675
Zinc finger FYVE domain-containing protein 21 (ZFYVE21) . Q9BQ24

References

1 Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.
2 A Chemical Proteomic Map of Heme-Protein Interactions. J Am Chem Soc. 2022 Aug 24;144(33):15013-15019. doi: 10.1021/jacs.2c06104. Epub 2022 Aug 12.
Mass spectrometry data entry: PXD034651
3 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
4 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
5 Mapping Protein Targets of Bioactive Small Molecules Using Lipid-Based Chemical Proteomics. ACS Chem Biol. 2017 Oct 20;12(10):2671-2681. doi: 10.1021/acschembio.7b00581. Epub 2017 Sep 20.
Mass spectrometry data entry: PXD007570