Details of the Target

General Information of Target

Target ID LDTP05809
Target Name Dehydrogenase/reductase SDR family member 2, mitochondrial (DHRS2)
Gene Name DHRS2
Gene ID 10202
Synonyms
SDR25C1; Dehydrogenase/reductase SDR family member 2, mitochondrial; EC 1.1.1.-; Dicarbonyl reductase HEP27; Protein D; Short chain dehydrogenase/reductase family 25C member 1; Protein SDR25C1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MLSAVARGYQGWFHPCARLSVRMSSTGIDRKGVLANRVAVVTGSTSGIGFAIARRLARDG
AHVVISSRKQQNVDRAMAKLQGEGLSVAGIVCHVGKAEDREQLVAKALEHCGGVDFLVCS
AGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQLLPYMENRRGAVILVSSIAAYNPVV
ALGVYNVSKTALLGLTRTLALELAPKDIRVNCVVPGIIKTDFSKVFHGNESLWKNFKEHH
QLQRIGESEDCAGIVSFLCSPDASYVNGENIAVAGYSTRL
Target Bioclass
Enzyme
Family
Short-chain dehydrogenases/reductases (SDR) family
Subcellular location
Mitochondrion matrix
Function
NADPH-dependent oxidoreductase which catalyzes the reduction of dicarbonyl compounds. Displays reductase activity in vitro with 3,4-hexanedione, 2,3-heptanedione and 1-phenyl-1,2-propanedione as substrates. May function as a dicarbonyl reductase in the enzymatic inactivation of reactive carbonyls involved in covalent modification of cellular components. Also displays a minor hydroxysteroid dehydrogenase activity toward bile acids such as ursodeoxycholic acid (UDCA) and isoursodeoxycholic acid (isoUDCA), which makes it unlikely to control hormone levels. Doesn't show any activity in vitro with retinoids and sugars as substrates. Attenuates MDM2-mediated p53/TP53 degradation, leading to p53/TP53 stabilization and increased transcription activity, resulting in the accumulation of MDM2 and CDKN1A/p21. Reduces proliferation, migration and invasion of cancer cells and well as the production of ROS in cancer.
Uniprot ID
Q13268
Ensemble ID
ENST00000250383.11
HGNC ID
HGNC:18349

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
ABC1 SNV: p.G43R DBIA    Probe Info 
COLO320 SNV: p.V38L DBIA    Probe Info 
COLO678 SNV: p.V38L DBIA    Probe Info 
COLO792 SNV: p.G253R DBIA    Probe Info 
COLO800 SNV: p.V38L .
HUH7 SNV: p.S260Y .
LS123 SNV: p.V38L DBIA    Probe Info 
MCC26 Substitution: p.R279Q .
NCIH716 SNV: p.V38L .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 6 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
W1
 Probe Info  		22.31  LDD0235  [1]
YN-1
 Probe Info  		100.00  LDD0444  [2]
YN-4
 Probe Info  		100.00  LDD0445  [2]
IPM
 Probe Info  		C92(0.00); C212(0.00); C251(0.00); C111(0.00)  LDD0241  [1]
DBIA
 Probe Info  		C92(1.19); C212(1.51)  LDD3310  [3]
Curcusone 37
 Probe Info  		2.34  LDD0188  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0237  AC12 HEK-293T C212(0.92)  LDD1510  [5]
 LDCM0280  AC20 HEK-293T C212(0.91)  LDD1519  [5]
 LDCM0288  AC28 HEK-293T C212(1.01)  LDD1527  [5]
 LDCM0297  AC36 HEK-293T C212(1.00)  LDD1536  [5]
 LDCM0301  AC4 HEK-293T C212(0.81)  LDD1540  [5]
 LDCM0306  AC44 HEK-293T C212(1.02)  LDD1545  [5]
 LDCM0315  AC52 HEK-293T C212(1.19)  LDD1554  [5]
 LDCM0324  AC60 HEK-293T C212(0.82)  LDD1563  [5]
 LDCM0408  CL20 HEK-293T C212(1.49)  LDD1612  [5]
 LDCM0421  CL32 HEK-293T C212(1.08)  LDD1625  [5]
 LDCM0434  CL44 HEK-293T C212(1.31)  LDD1638  [5]
 LDCM0447  CL56 HEK-293T C212(1.66)  LDD1650  [5]
 LDCM0460  CL68 HEK-293T C212(1.33)  LDD1663  [5]
 LDCM0473  CL8 HEK-293T C212(1.72)  LDD1676  [5]
 LDCM0474  CL80 HEK-293T C212(1.23)  LDD1677  [5]
 LDCM0487  CL92 HEK-293T C212(1.66)  LDD1690  [5]
 LDCM0033  Curcusone1d MCF-7 2.34  LDD0188  [4]
 LDCM0022  KB02 22RV1 C92(1.55)  LDD2243  [3]
 LDCM0023  KB03 22RV1 C92(1.92)  LDD2660  [3]
 LDCM0024  KB05 COLO792 C92(1.19); C212(1.51)  LDD3310  [3]
 LDCM0110  W12 Hep-G2 E238(0.67); H227(1.79); E230(2.05); N229(2.05)  LDD0237  [1]
 LDCM0111  W14 Hep-G2 K31(0.61); H227(1.52)  LDD0238  [1]
 LDCM0112  W16 Hep-G2 R209(0.70); K206(0.80); D207(0.80); H227(0.80)  LDD0239  [1]
 LDCM0113  W17 Hep-G2 K31(0.51); H239(13.46); H240(13.84)  LDD0240  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Amyloid protein-binding protein 2 (APPBP2) . Q92624

References

1 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
2 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
3 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
4 Total Synthesis and Target Identification of the Curcusone Diterpenes. J Am Chem Soc. 2021 Mar 24;143(11):4379-4386. doi: 10.1021/jacs.1c00557. Epub 2021 Mar 11.
5 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402