General Information of Target

Target ID LDTP02526
Target Name Clusterin (CLU)
Gene Name CLU
Gene ID 1191
Synonyms
APOJ; CLI; KUB1; Clusterin; Aging-associated gene 4 protein; Apolipoprotein J; Apo-J; Complement cytolysis inhibitor; CLI; Complement-associated protein SP-40,40; Ku70-binding protein 1; NA1/NA2; Sulfated glycoprotein 2; SGP-2; Testosterone-repressed prostate message 2; TRPM-2) [Cleaved into: Clusterin beta chain; ApoJalpha; Complement cytolysis inhibitor a chain; SP-40,40 beta-chain; Clusterin alpha chain; ApoJbeta; Complement cytolysis inhibitor b chain; SP-40,40 alpha-chain)]
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLI
EKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQT
CMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHF
SRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNF
HAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKD
QCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLE
QLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVP
VEVSRKNPKFMETVAEKALQEYRKKHREE
Target Type
Clinical trial
Target Bioclass
Other
Family
Clusterin family
Subcellular location
Secreted; Nucleus; Cytoplasm
Function
[Isoform 1]: Functions as extracellular chaperone that prevents aggregation of non native proteins. Prevents stress-induced aggregation of blood plasma proteins. Inhibits formation of amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA and aggregation-prone LYZ variants (in vitro). Does not require ATP. Maintains partially unfolded proteins in a state appropriate for subsequent refolding by other chaperones, such as HSPA8/HSC70. Does not refold proteins by itself. Binding to cell surface receptors triggers internalization of the chaperone-client complex and subsequent lysosomal or proteasomal degradation. Protects cells against apoptosis and against cytolysis by complement. Intracellular forms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes and promote the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes proteasomal degradation of COMMD1 and IKBKB. Modulates NF-kappa-B transcriptional activity. A mitochondrial form suppresses BAX-dependent release of cytochrome c into the cytoplasm and inhibit apoptosis. Plays a role in the regulation of cell proliferation. An intracellular form suppresses stress-induced apoptosis by stabilizing mitochondrial membrane integrity through interaction with HSPA5. Secreted form does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity. Secreted form act as an important modulator during neuronal differentiation through interaction with STMN3. Plays a role in the clearance of immune complexes that arise during cell injury.; [Isoform 6]: Does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity.; [Isoform 4]: Does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity. Promotes cell death through interaction with BCL2L1 that releases and activates BAX.
TTD ID
T95899
Uniprot ID
P10909
DrugMap ID
TTN8T0E
Ensemble ID
ENST00000316403.15
HGNC ID
HGNC:2095

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CCSW1 SNV: p.L21V .
MCC13 SNV: p.P318L .
NALM6 SNV: p.G52R .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 13 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
FBPP2
 Probe Info 
5.75  LDD0324  [1]
FBP2
 Probe Info 
2.70  LDD0323  [1]
STPyne
 Probe Info 
K123(7.23)  LDD0277  [2]
IPM
 Probe Info 
C313(0.00); C302(0.00)  LDD0241  [3]
OPA-S-S-alkyne
 Probe Info 
K222(0.58); K62(1.13); K322(1.38)  LDD3494  [4]
DBIA
 Probe Info 
C365(2.74)  LDD3373  [5]
HHS-475
 Probe Info 
Y341(0.81)  LDD0264  [6]
5E-2FA
 Probe Info 
H171(0.00); H392(0.00)  LDD2235  [7]
m-APA
 Probe Info 
H171(0.00); H392(0.00)  LDD2231  [7]
IA-alkyne
 Probe Info 
N.A.  LDD0162  [8]
Acrolein
 Probe Info 
H392(0.00); H217(0.00)  LDD0217  [9]
Crotonaldehyde
 Probe Info 
H392(0.00); C313(0.00)  LDD0219  [9]
NAIA_5
 Probe Info 
N.A.  LDD2223  [10]
PAL-AfBPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C275
 Probe Info 
5.21  LDD1945  [11]
C313
 Probe Info 
13.64  LDD1980  [11]
C344
 Probe Info 
5.03  LDD2006  [11]
Alk-rapa
 Probe Info 
2.05  LDD0213  [12]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa C313(0.00); H392(0.00); H217(0.00)  LDD0222  [9]
 LDCM0116  HHS-0101 DM93 Y341(0.81)  LDD0264  [6]
 LDCM0117  HHS-0201 DM93 Y341(0.60)  LDD0265  [6]
 LDCM0118  HHS-0301 DM93 Y341(0.73)  LDD0266  [6]
 LDCM0119  HHS-0401 DM93 Y341(0.55)  LDD0267  [6]
 LDCM0120  HHS-0701 DM93 Y341(1.13)  LDD0268  [6]
 LDCM0107  IAA HeLa H392(0.00); H217(0.00)  LDD0221  [9]
 LDCM0022  KB02 22RV1 C365(1.96)  LDD2243  [5]
 LDCM0023  KB03 22RV1 C365(2.69)  LDD2660  [5]
 LDCM0024  KB05 OCUG-1 C365(2.74)  LDD3373  [5]
 LDCM0109  NEM HeLa H392(0.00); H217(0.00)  LDD0223  [9]
 LDCM0090  Rapamycin JHH-7 2.05  LDD0213  [12]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Methionine-R-sulfoxide reductase B1 (MSRB1) MsrB Met sulfoxide reductase family Q9NZV6
Protein disulfide-isomerase A3 (PDIA3) Protein disulfide isomerase family P30101
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Amyloid-beta precursor protein (APP) APP family P05067
Alpha-synuclein (SNCA) Synuclein family P37840
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein c-Fos (FOS) BZIP family P01100
Peroxisome proliferator-activated receptor gamma (PPARG) Nuclear hormone receptor family P37231
Other
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Pituitary adenylate cyclase-activating polypeptide (ADCYAP1) Glucagon family P18509
Disrupted in schizophrenia 1 protein (DISC1) . Q9NRI5

The Drug(s) Related To This Target

Approved
Click To Hide/Show 5 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Copper . DB09130
Zinc . DB01593
Zinc Acetate . DB14487
Zinc Chloride . DB14533
Zinc Sulfate Unspecified Form . DB14548
Phase 3
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Custirsen Small molecular drug D0K3XS

References

1 Tranylcypromine specificity for monoamine oxidase is limited by promiscuous protein labelling and lysosomal trapping. RSC Chem Biol. 2020 Aug 12;1(4):209-213. doi: 10.1039/d0cb00048e. eCollection 2020 Oct 1.
Mass spectrometry data entry: PXD018580
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
4 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
5 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
6 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
7 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
8 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
9 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
10 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
11 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
12 Rapamycin targets STAT3 and impacts c-Myc to suppress tumor growth. Cell Chem Biol. 2022 Mar 17;29(3):373-385.e6. doi: 10.1016/j.chembiol.2021.10.006. Epub 2021 Oct 26.