Details of the Target

General Information of Target

Target ID LDTP15684
Target Name V-type proton ATPase subunit E 2 (ATP6V1E2)
Gene Name ATP6V1E2
Gene ID 90423
Synonyms
ATP6E1; ATP6EL2; ATP6V1EL2; V-type proton ATPase subunit E 2; V-ATPase subunit E 2; Vacuolar proton pump subunit E 2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MERHTSHPNRKVPAKEEANAVPLCRAKPSPSYINLQASSPPATFLNIQTTKLPSVDHKPK
ECLGLLECMYANLQLQTQLAQQQMAVLEHLQASVTQLAPGRGSNNSSLPALSPNPLLNHL
PQFSK
Target Bioclass
Enzyme
Family
V-ATPase E subunit family
Function
Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment.
Uniprot ID
Q96A05
Ensemble ID
ENST00000306448.4
HGNC ID
HGNC:18125

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 6 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info  		K52(5.79)  LDD2218  [1]
HHS-482
 Probe Info  		Y56(0.77)  LDD0285  [2]
HHS-475
 Probe Info  		Y56(0.85)  LDD0264  [3]
HHS-465
 Probe Info  		Y56(10.00)  LDD2237  [4]
DBIA
 Probe Info  		C136(0.88)  LDD1508  [5]
Acrolein
 Probe Info  		N.A.  LDD0217  [6]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0215  AC10 HEK-293T C136(0.88)  LDD1508  [5]
 LDCM0226  AC11 HEK-293T C136(1.16)  LDD1509  [5]
 LDCM0277  AC18 HEK-293T C136(0.99)  LDD1516  [5]
 LDCM0278  AC19 HEK-293T C136(0.80)  LDD1517  [5]
 LDCM0279  AC2 HEK-293T C136(0.92)  LDD1518  [5]
 LDCM0286  AC26 HEK-293T C136(1.23)  LDD1525  [5]
 LDCM0287  AC27 HEK-293T C136(1.10)  LDD1526  [5]
 LDCM0290  AC3 HEK-293T C136(1.12)  LDD1529  [5]
 LDCM0295  AC34 HEK-293T C136(0.95)  LDD1534  [5]
 LDCM0296  AC35 HEK-293T C136(1.09)  LDD1535  [5]
 LDCM0304  AC42 HEK-293T C136(0.99)  LDD1543  [5]
 LDCM0305  AC43 HEK-293T C136(1.00)  LDD1544  [5]
 LDCM0313  AC50 HEK-293T C136(0.94)  LDD1552  [5]
 LDCM0314  AC51 HEK-293T C136(1.18)  LDD1553  [5]
 LDCM0321  AC58 HEK-293T C136(1.28)  LDD1560  [5]
 LDCM0322  AC59 HEK-293T C136(0.93)  LDD1561  [5]
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [6]
 LDCM0405  CL18 HEK-293T C136(1.22)  LDD1609  [5]
 LDCM0406  CL19 HEK-293T C136(0.85)  LDD1610  [5]
 LDCM0419  CL30 HEK-293T C136(1.29)  LDD1623  [5]
 LDCM0420  CL31 HEK-293T C136(0.88)  LDD1624  [5]
 LDCM0432  CL42 HEK-293T C136(1.13)  LDD1636  [5]
 LDCM0433  CL43 HEK-293T C136(1.40)  LDD1637  [5]
 LDCM0445  CL54 HEK-293T C136(0.85)  LDD1648  [5]
 LDCM0446  CL55 HEK-293T C136(1.19)  LDD1649  [5]
 LDCM0451  CL6 HEK-293T C136(0.95)  LDD1654  [5]
 LDCM0458  CL66 HEK-293T C136(0.90)  LDD1661  [5]
 LDCM0459  CL67 HEK-293T C136(0.94)  LDD1662  [5]
 LDCM0462  CL7 HEK-293T C136(0.81)  LDD1665  [5]
 LDCM0471  CL78 HEK-293T C136(1.39)  LDD1674  [5]
 LDCM0472  CL79 HEK-293T C136(1.00)  LDD1675  [5]
 LDCM0485  CL90 HEK-293T C136(0.81)  LDD1688  [5]
 LDCM0486  CL91 HEK-293T C136(0.94)  LDD1689  [5]
 LDCM0116  HHS-0101 DM93 Y56(0.85)  LDD0264  [3]
 LDCM0117  HHS-0201 DM93 Y56(0.76)  LDD0265  [3]
 LDCM0118  HHS-0301 DM93 Y56(0.87)  LDD0266  [3]
 LDCM0119  HHS-0401 DM93 Y56(0.79)  LDD0267  [3]
 LDCM0120  HHS-0701 DM93 Y56(0.93)  LDD0268  [3]
 LDCM0107  IAA HeLa N.A.  LDD0221  [6]
 LDCM0123  JWB131 DM93 Y56(0.77)  LDD0285  [2]
 LDCM0124  JWB142 DM93 Y56(0.87)  LDD0286  [2]
 LDCM0125  JWB146 DM93 Y56(0.81)  LDD0287  [2]
 LDCM0126  JWB150 DM93 Y56(2.22)  LDD0288  [2]
 LDCM0127  JWB152 DM93 Y56(1.77)  LDD0289  [2]
 LDCM0128  JWB198 DM93 Y56(1.18)  LDD0290  [2]
 LDCM0129  JWB202 DM93 Y56(0.76)  LDD0291  [2]
 LDCM0130  JWB211 DM93 Y56(1.02)  LDD0292  [2]
 LDCM0109  NEM HeLa N.A.  LDD0224  [6]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
V-type proton ATPase subunit G 2 (ATP6V1G2) V-ATPase G subunit family O95670
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
V-type proton ATPase subunit G 1 (ATP6V1G1) V-ATPase G subunit family O75348
Other
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
LRP chaperone MESD (MESD) MESD family Q14696
Bublin coiled-coil protein (BBLN) UPF0184 (EST00098) family Q9BUW7
Ras association domain-containing protein 10 (RASSF10) . A6NK89

The Drug(s) Related To This Target

Approved
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Tiludronic Acid Small molecular drug DB01133

References

1 Global profiling of lysine reactivity and ligandability in the human proteome. Nat Chem. 2017 Dec;9(12):1181-1190. doi: 10.1038/nchem.2826. Epub 2017 Jul 31.
2 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
3 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
4 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
5 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
6 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.