Details of the Target
General Information of Target
| Target ID | LDTP09656 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cytoglobin (CYGB) | |||||
| Gene Name | CYGB | |||||
| Gene ID | 114757 | |||||
| Synonyms |
STAP; Cytoglobin; Histoglobin; HGb; Nitric oxygen dioxygenase CYGB; NOD; EC 1.14.12.-; Nitrite reductase CYGB; EC 1.7.-.-; Pseudoperoxidase CYGB; EC 1.11.1.-; Stellate cell activation-associated protein; Superoxide dismutase CYGB; EC 1.15.1.1
|
|||||
| 3D Structure | ||||||
| Sequence |
MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYF
SQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVE PVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATT PPATLPSSGP |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Globin family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Probable multifunctional globin with a hexacoordinated heme iron required for the catalysis of various reactions depending on redox condition of the cell as well as oxygen availability . Has a nitric oxide dioxygenase (NOD) activity and is most probably involved in cell-mediated and oxygen-dependent nitric oxide consumption. By scavenging this second messenger may regulate several biological processes including endothelium-mediated vasodilation and vascular tone. Under normoxic conditions functions as a nitric oxide dioxygenase (NOD) but under hypoxic conditions the globin may switch its function to that of a nitrite (NO2) reductase (NiR), generating nitric oxide. Could also have peroxidase and superoxide dismutase activities, detoxifying reactive oxygen species and protecting cells against oxidative stress. Also binds dioxygen with low affinity and could function as an oxygen sensor but has probably no function as a respiratory oxygen carrier.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C38(1.86) | LDD3332 | [1] | |
|
HHS-482 Probe Info |
![]() |
Y123(1.13); Y159(1.66) | LDD0285 | [2] | |
|
HHS-475 Probe Info |
![]() |
Y159(0.80); Y123(1.12) | LDD0264 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0116 | HHS-0101 | DM93 | Y159(0.80); Y123(1.12) | LDD0264 | [3] |
| LDCM0117 | HHS-0201 | DM93 | Y159(0.66); Y123(0.97) | LDD0265 | [3] |
| LDCM0118 | HHS-0301 | DM93 | Y159(0.75); Y123(1.33) | LDD0266 | [3] |
| LDCM0119 | HHS-0401 | DM93 | Y159(1.29); Y123(1.31) | LDD0267 | [3] |
| LDCM0120 | HHS-0701 | DM93 | Y159(0.60); Y123(1.14) | LDD0268 | [3] |
| LDCM0123 | JWB131 | DM93 | Y123(1.13); Y159(1.66) | LDD0285 | [2] |
| LDCM0124 | JWB142 | DM93 | Y123(1.24); Y159(3.24) | LDD0286 | [2] |
| LDCM0125 | JWB146 | DM93 | Y123(1.29); Y159(1.00) | LDD0287 | [2] |
| LDCM0126 | JWB150 | DM93 | Y123(3.71); Y159(3.80) | LDD0288 | [2] |
| LDCM0127 | JWB152 | DM93 | Y123(2.34); Y159(3.29) | LDD0289 | [2] |
| LDCM0128 | JWB198 | DM93 | Y123(0.95); Y159(1.63) | LDD0290 | [2] |
| LDCM0129 | JWB202 | DM93 | Y123(0.92); Y159(0.52) | LDD0291 | [2] |
| LDCM0130 | JWB211 | DM93 | Y123(1.51); Y159(0.98) | LDD0292 | [2] |
| LDCM0022 | KB02 | A2058 | C38(1.37) | LDD2253 | [1] |
| LDCM0023 | KB03 | A2058 | C38(2.22) | LDD2670 | [1] |
| LDCM0024 | KB05 | MKN45 | C38(1.86) | LDD3332 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Aflatoxin B1 aldehyde reductase member 2 (AKR7A2) | Aldo/keto reductase family | O43488 | |||
| Protein DDI1 homolog 1 (DDI1) | DDI1 family | Q8WTU0 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Protein LRATD1 (LRATD1) | LRATD family | Q96KN4 | |||
| Mitotic-spindle organizing protein 1 (MZT1) | MOZART1 family | Q08AG7 | |||
References



