Details of the Target

General Information of Target

Target ID LDTP07984
Target Name Charged multivesicular body protein 1b (CHMP1B)
Gene Name CHMP1B
Gene ID 57132
Synonyms
C18orf2; Charged multivesicular body protein 1b; CHMP1.5; Chromatin-modifying protein 1b; CHMP1b; Vacuolar protein sorting-associated protein 46-2; Vps46-2; hVps46-2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKN
QAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEH
QFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSV
ASAEQDELSQRLARLRDQV
Target Bioclass
Other
Family
SNF7 family
Subcellular location
Cytoplasm, cytosol
Function
Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in cytokinesis. Involved in recruiting VPS4A and/or VPS4B and SPAST to the midbody of dividing cells. Involved in HIV-1 p6- and p9-dependent virus release.
Uniprot ID
Q7LBR1
Ensemble ID
ENST00000526991.3
HGNC ID
HGNC:24287

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 11 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C-Sul
 Probe Info  		9.79  LDD0066  [1]
FBP2
 Probe Info  		6.41  LDD0323  [2]
STPyne
 Probe Info  		K16(10.00); K42(6.18); K90(4.19); K97(9.08)  LDD0277  [3]
IPM
 Probe Info  		N.A.  LDD0241  [4]
BTD
 Probe Info  		C25(2.46)  LDD2094  [5]
ATP probe
 Probe Info  		N.A.  LDD0199  [6]
IA-alkyne
 Probe Info  		N.A.  LDD0162  [7]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [8]
TFBX
 Probe Info  		N.A.  LDD0148  [9]
Acrolein
 Probe Info  		N.A.  LDD0217  [10]
NAIA_5
 Probe Info  		N.A.  LDD2223  [11]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0524  2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide MDA-MB-231 C25(1.65)  LDD2117  [5]
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [10]
 LDCM0107  IAA HeLa N.A.  LDD0221  [10]
 LDCM0109  NEM HeLa N.A.  LDD0223  [10]
 LDCM0501  Nucleophilic fragment 13b MDA-MB-231 C25(2.46)  LDD2094  [5]
 LDCM0504  Nucleophilic fragment 15a MDA-MB-231 C25(0.95)  LDD2097  [5]
 LDCM0508  Nucleophilic fragment 17a MDA-MB-231 C25(0.95)  LDD2101  [5]
 LDCM0523  Nucleophilic fragment 24b MDA-MB-231 C25(0.53)  LDD2116  [5]
 LDCM0525  Nucleophilic fragment 25b MDA-MB-231 C25(0.70)  LDD2118  [5]
 LDCM0530  Nucleophilic fragment 28a MDA-MB-231 C25(0.38)  LDD2123  [5]
 LDCM0533  Nucleophilic fragment 29b MDA-MB-231 C25(0.46)  LDD2126  [5]
 LDCM0535  Nucleophilic fragment 30b MDA-MB-231 C25(1.02)  LDD2128  [5]
 LDCM0540  Nucleophilic fragment 35 MDA-MB-231 C25(0.21)  LDD2133  [5]
 LDCM0541  Nucleophilic fragment 36 MDA-MB-231 C25(0.44)  LDD2134  [5]
 LDCM0546  Nucleophilic fragment 40 MDA-MB-231 C25(0.71)  LDD2140  [5]
 LDCM0547  Nucleophilic fragment 41 MDA-MB-231 C25(0.81)  LDD2141  [5]
 LDCM0549  Nucleophilic fragment 43 MDA-MB-231 C25(1.61)  LDD2143  [5]
 LDCM0552  Nucleophilic fragment 6a MDA-MB-231 C25(0.55)  LDD2146  [5]
 LDCM0553  Nucleophilic fragment 6b MDA-MB-231 C25(8.79)  LDD2147  [5]
 LDCM0554  Nucleophilic fragment 7a MDA-MB-231 C25(0.41)  LDD2148  [5]
 LDCM0557  Nucleophilic fragment 8b MDA-MB-231 C25(0.63)  LDD2151  [5]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Vacuolar protein sorting-associated protein 4A (VPS4A) AAA ATPase family Q9UN37
U5 small nuclear ribonucleoprotein 200 kDa helicase (SNRNP200) Helicase family O75643
Ubiquitin carboxyl-terminal hydrolase 8 (USP8) Peptidase C19 family P40818
STAM-binding protein (STAMBP) Peptidase M67C family O95630
Ras-related protein Rab-11A (RAB11A) Rab family P62491
Other
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Charged multivesicular body protein 1b (CHMP1B) SNF7 family Q7LBR1
Vacuolar protein sorting-associated protein VTA1 homolog (VTA1) VTA1 family Q9NP79
MIT domain-containing protein 1 (MITD1) . Q8WV92
PRKCA-binding protein (PICK1) . Q9NRD5

References

1 Low-Toxicity Sulfonium-Based Probes for Cysteine-Specific Profiling in Live Cells. Anal Chem. 2022 Mar 15;94(10):4366-4372. doi: 10.1021/acs.analchem.1c05129. Epub 2022 Mar 4.
2 Tranylcypromine specificity for monoamine oxidase is limited by promiscuous protein labelling and lysosomal trapping. RSC Chem Biol. 2020 Aug 12;1(4):209-213. doi: 10.1039/d0cb00048e. eCollection 2020 Oct 1.
Mass spectrometry data entry: PXD018580
3 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
4 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
5 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
6 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
7 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
8 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
9 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
10 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
11 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264