Details of the Target

General Information of Target

Target ID LDTP07136
Target Name Keratinocyte proline-rich protein (KPRP)
Gene Name KPRP
Gene ID 448834
Synonyms
C1orf45; Keratinocyte proline-rich protein; hKPRP
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MCDQQQIQCRLPLQQCCVKGPSFCSSQSPFAQSQVVVQAPCEMQIVDCPASCPVQVCQVS
DQAPCQSQTTQVKCQSKTKQVKGQAQCQSKTTQVKGQAASQSQTSSVQSQAPCQSEVSYV
QCEASQPVQTCFVECAPVCYTETCYVECPVQNYVPCPAPQPVQMYRGRPAVCQPQGRFST
QCQYQGSYSSCGPQFQSRATCNNYTPQFQLRPSYSSCFPQYRSRTSFSPCVPQCQTQGSY
GSFTEQHRSRSTSRCLPPPRRLQLFPRSCSPPRRFEPCSSSYLPLRPSEGFPNYCTPPRR
SEPIYNSRCPRRPISSCSQRRGPKCRIEISSPCCPRQVPPQRCPVEIPPIRRRSQSCGPQ
PSWGASCPELRPHVEPRPLPSFCPPRRLDQCPESPLQRCPPPAPRPRLRPEPCISLEPRP
RPLPRQLSEPCLYPEPLPALRPTPRPVPLPRPGQCEIPEPRPCLQPCEHPEPCPRPEPIP
LPAPCPSPEPCRETWRSPSPCWGPNPVPYPGDLGCHESSPHRLDTEAPYCGPSSYNQGQE
SGAGCGPGDVFPERRGQDGHGDQGNAFAGVKGEAKSAYF
Target Bioclass
Other
Subcellular location
Cytoplasm
Uniprot ID
Q5T749
Ensemble ID
ENST00000606109.2
HGNC ID
HGNC:31823

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
AF-1
 Probe Info  		3.05  LDD0421  [1]
IMP-1710
 Probe Info  		11.30  LDD0040  [2]
PAL-AfBPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
FFF probe11
 Probe Info  		20.00  LDD0471  [3]
FFF probe12
 Probe Info  		20.00  LDD0473  [3]
FFF probe15
 Probe Info  		20.00  LDD0478  [3]
FFF probe3
 Probe Info  		20.00  LDD0464  [3]
FFF probe9
 Probe Info  		20.00  LDD0470  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0166  Afatinib A431 3.05  LDD0421  [1]
 LDCM0001  Panyain_cp1 HEK-293T 11.30  LDD0040  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 14 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
3 beta-hydroxysteroid dehydrogenase type 7 (HSD3B7) 3-beta-HSD family Q9H2F3
Peptidyl-prolyl cis-trans isomerase-like 1 (PPIL1) Cyclophilin-type PPIase family Q9Y3C6
Retinol-binding protein 3 (RBP3) Peptidase S41A family P10745
Group 10 secretory phospholipase A2 (PLA2G10) Phospholipase A2 family O15496
Dual specificity tyrosine-phosphorylation-regulated kinase 1A (DYRK1A) CMGC Ser/Thr protein kinase family Q13627
Serine/threonine-protein kinase 16 (STK16) Ser/Thr protein kinase family O75716
Platelet-derived growth factor receptor beta (PDGFRB) Tyr protein kinase family P09619
Tensin-2 (TNS2) PTEN phosphatase protein family Q63HR2
Tripartite motif-containing protein 42 (TRIM42) TRIM/RBCC family Q8IWZ5
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
E3 ubiquitin-protein ligase RNF38 (RNF38) . Q9H0F5
F-box only protein 17 (FBXO17) . Q96EF6
Glutaredoxin-3 (GLRX3) . O76003
Ubiquitin-associated and SH3 domain-containing protein B (UBASH3B) . Q8TF42
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Metal transporter CNNM3 (CNNM3) ACDP family Q8NE01
Cation channel sperm-associated protein 1 (CATSPER1) Cation channel sperm-associated (TC 1.A.1.19) family Q8NEC5
Solute carrier family 15 member 2 (SLC15A2) Proton-dependent oligopeptide transporter (POT/PTR) (TC 2.A.17) family Q16348
Phospholipid scramblase 4 (PLSCR4) Phospholipid scramblase family Q9NRQ2
Transcription factor
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-C8 (HOXC8) Antp homeobox family P31273
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Transcription factor AP-2-delta (TFAP2D) AP-2 family Q7Z6R9
Doublesex- and mab-3-related transcription factor 3 (DMRT3) DMRT family Q9NQL9
Zinc finger protein 587 (ZNF587) Krueppel C2H2-type zinc-finger protein family Q96SQ5
Nuclear receptor subfamily 4 group A member 3 (NR4A3) Nuclear hormone receptor family Q92570
Homeobox protein OTX1 (OTX1) Paired homeobox family P32242
POU domain, class 4, transcription factor 2 (POU4F2) POU transcription factor family Q12837
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Neuropeptides B/W receptor type 2 (NPBWR2) G-protein coupled receptor 1 family P48146
Other
Click To Hide/Show 53 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
A-kinase anchor protein 8-like (AKAP8L) AKAP95 family Q9ULX6
Cyclin-dependent kinases regulatory subunit 1 (CKS1B) CKS family P61024
Cornifelin (CNFN) Cornifelin family Q9BYD5
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
DNA mismatch repair protein Mlh1 (MLH1) DNA mismatch repair MutL/HexB family P40692
Eukaryotic translation initiation factor 3 subunit E (EIF3E) EIF-3 subunit E family P60228
Protein FAM221B (FAM221B) FAM221 family A6H8Z2
GRB2-related adapter protein 2 (GRAP2) GRB2/sem-5/DRK family O75791
Protein HEXIM2 (HEXIM2) HEXIM family Q96MH2
Inter-alpha-trypsin inhibitor heavy chain H6 (ITIH6) ITIH family Q6UXX5
Keratin-associated protein 1-3 (KRTAP1-3) KRTAP type 1 family Q8IUG1
Keratin-associated protein 1-5 (KRTAP1-5) KRTAP type 1 family Q9BYS1
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Keratin-associated protein 12-3 (KRTAP12-3) KRTAP type 12 family P60328
Keratin-associated protein 19-1 (KRTAP19-1) KRTAP type 19 family Q8IUB9
Keratin-associated protein 19-2 (KRTAP19-2) KRTAP type 19 family Q3LHN2
Keratin-associated protein 19-5 (KRTAP19-5) KRTAP type 19 family Q3LI72
Keratin-associated protein 19-6 (KRTAP19-6) KRTAP type 19 family Q3LI70
Keratin-associated protein 19-7 (KRTAP19-7) KRTAP type 19 family Q3SYF9
Keratin-associated protein 3-2 (KRTAP3-2) KRTAP type 3 family Q9BYR7
Keratin-associated protein 4-2 (KRTAP4-2) KRTAP type 4 family Q9BYR5
Keratin-associated protein 4-5 (KRTAP4-5) KRTAP type 4 family Q9BYR2
Keratin-associated protein 5-3 (KRTAP5-3) KRTAP type 5 family Q6L8H2
Keratin-associated protein 5-7 (KRTAP5-7) KRTAP type 5 family Q6L8G8
Keratin-associated protein 5-9 (KRTAP5-9) KRTAP type 5 family P26371
Keratin-associated protein 6-1 (KRTAP6-1) KRTAP type 6 family Q3LI64
Keratin-associated protein 6-2 (KRTAP6-2) KRTAP type 6 family Q3LI66
Late cornified envelope protein 3C (LCE3C) LCE family Q5T5A8
Late cornified envelope protein 3D (LCE3D) LCE family Q9BYE3
Late cornified envelope protein 3E (LCE3E) LCE family Q5T5B0
Notch homolog 2 N-terminal-like protein C (NOTCH2NLC) NOTCH family P0DPK4
Keratin-associated protein 13-2 (KRTAP13-2) PMG family Q52LG2
Keratin-associated protein 13-3 (KRTAP13-3) PMG family Q3SY46
Keratin-associated protein 15-1 (KRTAP15-1) PMG family Q3LI76
Protein sprouty homolog 1 (SPRY1) Sprouty family O43609
Protein sprouty homolog 3 (SPRY3) Sprouty family O43610
Tektin-4 (TEKT4) Tektin family Q8WW24
Thyroid receptor-interacting protein 6 (TRIP6) Zyxin/ajuba family Q15654
Brorin (VWC2) . Q2TAL6
Collagen alpha-1(VIII) chain (COL8A1) . P27658
Cytoplasmic protein NCK2 (NCK2) . O43639
Fibroblast growth factor receptor substrate 3 (FRS3) . O43559
FMR1-interacting protein NUFIP2 (NUFIP2) . Q7Z417
Four and a half LIM domains protein 2 (FHL2) . Q14192
Four and a half LIM domains protein 3 (FHL3) . Q13643
Heterogeneous nuclear ribonucleoprotein F (HNRNPF) . P52597
Migration and invasion-inhibitory protein (MIIP) . Q5JXC2
Mitogen-activated protein kinase-binding protein 1 (MAPKBP1) . O60336
Netrin-4 (NTN4) . Q9HB63
Probetacellulin (BTC) . P35070
Ral guanine nucleotide dissociation stimulator-like 2 (RGL2) . O15211
SH3 domain-containing kinase-binding protein 1 (SH3KBP1) . Q96B97
Sprouty-related, EVH1 domain-containing protein 2 (SPRED2) . Q7Z698

References

1 Minimalist linkers suitable for irreversible inhibitors in simultaneous proteome profiling, live-cell imaging and drug screening. Chem Commun (Camb). 2019 Jan 15;55(6):834-837. doi: 10.1039/c8cc08685k.
2 Correction to "Discovery of a Potent and Selective Covalent Inhibitor and Activity-Based Probe for the Deubiquitylating Enzyme UCHL1, with Antifibrotic Activity". J Am Chem Soc. 2020 Sep 2;142(35):15199. doi: 10.1021/jacs.0c08385. Epub 2020 Aug 19.
Mass spectrometry data entry: PXD015825
3 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.