General Information of Target

Target ID LDTP06271
Target Name ER membrane protein complex subunit 2 (EMC2)
Gene Name EMC2
Gene ID 9694
Synonyms
KIAA0103; TTC35; ER membrane protein complex subunit 2; Tetratricopeptide repeat protein 35; TPR repeat protein 35
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAKVSELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVM
IAALDYGRDDLALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTN
TAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQEAWHELAELYINEHDYAKAAFCLEE
LMMTNPHNHLYCQQYAEVKYTQGGLENLELSRKYFAQALKLNNRNMRALFGLYMSASHIA
SNPKASAKTKKDNMKYASWAASQINRAYQFAGRSKKETKYSLKAVEDMLETLQITQS
Target Bioclass
Transporter and channel
Family
EMC2 family
Subcellular location
Endoplasmic reticulum membrane
Function
Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins . Preferentially accommodates proteins with transmembrane domains that are weakly hydrophobic or contain destabilizing features such as charged and aromatic residues. Involved in the cotranslational insertion of multi-pass membrane proteins in which stop-transfer membrane-anchor sequences become ER membrane spanning helices. It is also required for the post-translational insertion of tail-anchored/TA proteins in endoplasmic reticulum membranes. By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, with translocated N-terminus in the lumen of the ER, controls the topology of multi-pass membrane proteins like the G protein-coupled receptors. By regulating the insertion of various proteins in membranes, it is indirectly involved in many cellular processes (Probable).
Uniprot ID
Q15006
Ensemble ID
ENST00000220853.8
HGNC ID
HGNC:28963

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info 
K251(7.14)  LDD0277  [1]
DBIA
 Probe Info 
C192(0.80)  LDD1510  [2]
5E-2FA
 Probe Info 
N.A.  LDD2235  [3]
m-APA
 Probe Info 
N.A.  LDD2231  [3]
NAIA_5
 Probe Info 
N.A.  LDD2223  [4]
PAL-AfBPP Probe
Click To Hide/Show 9 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C201
 Probe Info 
24.42  LDD1877  [5]
C206
 Probe Info 
15.24  LDD1881  [5]
C278
 Probe Info 
53.45  LDD1948  [5]
C284
 Probe Info 
26.91  LDD1954  [5]
C338
 Probe Info 
13.55  LDD2001  [5]
C350
 Probe Info 
22.94  LDD2011  [5]
C388
 Probe Info 
40.79  LDD2047  [5]
C431
 Probe Info 
14.72  LDD2086  [5]
STS-2
 Probe Info 
N.A.  LDD0138  [6]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0237  AC12 HEK-293T C192(0.80)  LDD1510  [2]
 LDCM0280  AC20 HEK-293T C192(0.86)  LDD1519  [2]
 LDCM0288  AC28 HEK-293T C192(0.95)  LDD1527  [2]
 LDCM0297  AC36 HEK-293T C192(1.04)  LDD1536  [2]
 LDCM0301  AC4 HEK-293T C192(1.10)  LDD1540  [2]
 LDCM0306  AC44 HEK-293T C192(0.95)  LDD1545  [2]
 LDCM0315  AC52 HEK-293T C192(0.96)  LDD1554  [2]
 LDCM0324  AC60 HEK-293T C192(0.80)  LDD1563  [2]
 LDCM0372  CL103 HEK-293T C192(0.86)  LDD1576  [2]
 LDCM0376  CL107 HEK-293T C192(0.97)  LDD1580  [2]
 LDCM0381  CL111 HEK-293T C192(0.85)  LDD1585  [2]
 LDCM0385  CL115 HEK-293T C192(0.95)  LDD1589  [2]
 LDCM0389  CL119 HEK-293T C192(0.90)  LDD1593  [2]
 LDCM0394  CL123 HEK-293T C192(0.80)  LDD1598  [2]
 LDCM0398  CL127 HEK-293T C192(0.89)  LDD1602  [2]
 LDCM0402  CL15 HEK-293T C192(0.89)  LDD1606  [2]
 LDCM0408  CL20 HEK-293T C192(0.99)  LDD1612  [2]
 LDCM0415  CL27 HEK-293T C192(0.90)  LDD1619  [2]
 LDCM0418  CL3 HEK-293T C192(1.02)  LDD1622  [2]
 LDCM0421  CL32 HEK-293T C192(0.75)  LDD1625  [2]
 LDCM0428  CL39 HEK-293T C192(1.10)  LDD1632  [2]
 LDCM0434  CL44 HEK-293T C192(0.85)  LDD1638  [2]
 LDCM0447  CL56 HEK-293T C192(1.06)  LDD1650  [2]
 LDCM0455  CL63 HEK-293T C192(0.91)  LDD1658  [2]
 LDCM0460  CL68 HEK-293T C192(1.05)  LDD1663  [2]
 LDCM0473  CL8 HEK-293T C192(0.95)  LDD1676  [2]
 LDCM0474  CL80 HEK-293T C192(0.81)  LDD1677  [2]
 LDCM0481  CL87 HEK-293T C192(1.26)  LDD1684  [2]
 LDCM0487  CL92 HEK-293T C192(0.99)  LDD1690  [2]
 LDCM0494  CL99 HEK-293T C192(1.03)  LDD1697  [2]
 LDCM0495  E2913 HEK-293T C192(0.95)  LDD1698  [2]
 LDCM0468  Fragment33 HEK-293T C192(0.84)  LDD1671  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ER membrane protein complex subunit 3 (EMC3) EMC3 family Q9P0I2
ER membrane protein complex subunit 8 (EMC8) EMC8/EMC9 family O43402
ER membrane protein complex subunit 9 (EMC9) EMC8/EMC9 family Q9Y3B6
ER membrane protein complex subunit 5 (MMGT1) Membrane magnesium transporter (TC 1.A.67) family Q8N4V1
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein Aiolos (IKZF3) Ikaros C2H2-type zinc-finger protein family Q9UKT9
Other
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
SH3 domain-binding protein 5-like (SH3BP5L) SH3BP5 family Q7L8J4
SS18-like protein 2 (SS18L2) SS18 family Q9UHA2
Protocadherin beta-12 (PCDHB12) . Q9Y5F1

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
3 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
4 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
5 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
6 Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.