Details of the Target
General Information of Target
Target ID | LDTP06271 | |||||
---|---|---|---|---|---|---|
Target Name | ER membrane protein complex subunit 2 (EMC2) | |||||
Gene Name | EMC2 | |||||
Gene ID | 9694 | |||||
Synonyms |
KIAA0103; TTC35; ER membrane protein complex subunit 2; Tetratricopeptide repeat protein 35; TPR repeat protein 35 |
|||||
3D Structure | ||||||
Sequence |
MAKVSELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVM
IAALDYGRDDLALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTN TAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQEAWHELAELYINEHDYAKAAFCLEE LMMTNPHNHLYCQQYAEVKYTQGGLENLELSRKYFAQALKLNNRNMRALFGLYMSASHIA SNPKASAKTKKDNMKYASWAASQINRAYQFAGRSKKETKYSLKAVEDMLETLQITQS |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
EMC2 family
|
|||||
Subcellular location |
Endoplasmic reticulum membrane
|
|||||
Function |
Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins . Preferentially accommodates proteins with transmembrane domains that are weakly hydrophobic or contain destabilizing features such as charged and aromatic residues. Involved in the cotranslational insertion of multi-pass membrane proteins in which stop-transfer membrane-anchor sequences become ER membrane spanning helices. It is also required for the post-translational insertion of tail-anchored/TA proteins in endoplasmic reticulum membranes. By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, with translocated N-terminus in the lumen of the ER, controls the topology of multi-pass membrane proteins like the G protein-coupled receptors. By regulating the insertion of various proteins in membranes, it is indirectly involved in many cellular processes (Probable).
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STPyne Probe Info |
![]() |
K251(7.14) | LDD0277 | [1] | |
DBIA Probe Info |
![]() |
C192(0.80) | LDD1510 | [2] | |
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [3] | |
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [3] | |
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [4] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C201 Probe Info |
![]() |
24.42 | LDD1877 | [5] | |
C206 Probe Info |
![]() |
15.24 | LDD1881 | [5] | |
C278 Probe Info |
![]() |
53.45 | LDD1948 | [5] | |
C284 Probe Info |
![]() |
26.91 | LDD1954 | [5] | |
C338 Probe Info |
![]() |
13.55 | LDD2001 | [5] | |
C350 Probe Info |
![]() |
22.94 | LDD2011 | [5] | |
C388 Probe Info |
![]() |
40.79 | LDD2047 | [5] | |
C431 Probe Info |
![]() |
14.72 | LDD2086 | [5] | |
STS-2 Probe Info |
![]() |
N.A. | LDD0138 | [6] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0237 | AC12 | HEK-293T | C192(0.80) | LDD1510 | [2] |
LDCM0280 | AC20 | HEK-293T | C192(0.86) | LDD1519 | [2] |
LDCM0288 | AC28 | HEK-293T | C192(0.95) | LDD1527 | [2] |
LDCM0297 | AC36 | HEK-293T | C192(1.04) | LDD1536 | [2] |
LDCM0301 | AC4 | HEK-293T | C192(1.10) | LDD1540 | [2] |
LDCM0306 | AC44 | HEK-293T | C192(0.95) | LDD1545 | [2] |
LDCM0315 | AC52 | HEK-293T | C192(0.96) | LDD1554 | [2] |
LDCM0324 | AC60 | HEK-293T | C192(0.80) | LDD1563 | [2] |
LDCM0372 | CL103 | HEK-293T | C192(0.86) | LDD1576 | [2] |
LDCM0376 | CL107 | HEK-293T | C192(0.97) | LDD1580 | [2] |
LDCM0381 | CL111 | HEK-293T | C192(0.85) | LDD1585 | [2] |
LDCM0385 | CL115 | HEK-293T | C192(0.95) | LDD1589 | [2] |
LDCM0389 | CL119 | HEK-293T | C192(0.90) | LDD1593 | [2] |
LDCM0394 | CL123 | HEK-293T | C192(0.80) | LDD1598 | [2] |
LDCM0398 | CL127 | HEK-293T | C192(0.89) | LDD1602 | [2] |
LDCM0402 | CL15 | HEK-293T | C192(0.89) | LDD1606 | [2] |
LDCM0408 | CL20 | HEK-293T | C192(0.99) | LDD1612 | [2] |
LDCM0415 | CL27 | HEK-293T | C192(0.90) | LDD1619 | [2] |
LDCM0418 | CL3 | HEK-293T | C192(1.02) | LDD1622 | [2] |
LDCM0421 | CL32 | HEK-293T | C192(0.75) | LDD1625 | [2] |
LDCM0428 | CL39 | HEK-293T | C192(1.10) | LDD1632 | [2] |
LDCM0434 | CL44 | HEK-293T | C192(0.85) | LDD1638 | [2] |
LDCM0447 | CL56 | HEK-293T | C192(1.06) | LDD1650 | [2] |
LDCM0455 | CL63 | HEK-293T | C192(0.91) | LDD1658 | [2] |
LDCM0460 | CL68 | HEK-293T | C192(1.05) | LDD1663 | [2] |
LDCM0473 | CL8 | HEK-293T | C192(0.95) | LDD1676 | [2] |
LDCM0474 | CL80 | HEK-293T | C192(0.81) | LDD1677 | [2] |
LDCM0481 | CL87 | HEK-293T | C192(1.26) | LDD1684 | [2] |
LDCM0487 | CL92 | HEK-293T | C192(0.99) | LDD1690 | [2] |
LDCM0494 | CL99 | HEK-293T | C192(1.03) | LDD1697 | [2] |
LDCM0495 | E2913 | HEK-293T | C192(0.95) | LDD1698 | [2] |
LDCM0468 | Fragment33 | HEK-293T | C192(0.84) | LDD1671 | [2] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
Transcription factor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Zinc finger protein Aiolos (IKZF3) | Ikaros C2H2-type zinc-finger protein family | Q9UKT9 |
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
SH3 domain-binding protein 5-like (SH3BP5L) | SH3BP5 family | Q7L8J4 | |||
SS18-like protein 2 (SS18L2) | SS18 family | Q9UHA2 | |||
Protocadherin beta-12 (PCDHB12) | . | Q9Y5F1 |
References