Details of the Target
General Information of Target
| Target ID | LDTP05711 | |||||
|---|---|---|---|---|---|---|
| Target Name | Nuclear inhibitor of protein phosphatase 1 (PPP1R8) |
|
||||
| Gene Name | PPP1R8 | |||||
| Gene ID | 5511 | |||||
| Synonyms |
ARD1; NIPP1; Nuclear inhibitor of protein phosphatase 1; NIPP-1; Protein phosphatase 1 regulatory inhibitor subunit 8) [Includes: Activator of RNA decay; EC 3.1.4.-; ARD-1)] |
|||||
| 3D Structure | ||||||
| Sequence |
MAAAANSGSSLPLFDCPTWAGKPPPGLHLDVVKGDKLIEKLIIDEKKYYLFGRNPDLCDF
TIDHQSCSRVHAALVYHKHLKRVFLIDLNSTHGTFLGHIRLEPHKPQQIPIDSTVSFGAS TRAYTLREKPQTLPSAVKGDEKMGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTL TIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEG PGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPD VDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm; Nucleus
|
|||||
| Function |
Inhibitor subunit of the major nuclear protein phosphatase-1 (PP-1). It has RNA-binding activity but does not cleave RNA and may target PP-1 to RNA-associated substrates. May also be involved in pre-mRNA splicing. Binds DNA and might act as a transcriptional repressor. Seems to be required for cell proliferation.; Isoform Gamma is a site-specific single-strand endoribonuclease that cleaves single strand RNA 3' to purines and pyrimidines in A+U-rich regions. It generates 5'-phosphate termini at the site of cleavage. This isoform does not inhibit PP-1. May be implicated in mRNA splicing.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K47(8.93) | LDD0277 | [1] | |
|
HHS-475 Probe Info |
 |
Y48(0.67) | LDD0264 | [2] | |
|
5E-2FA Probe Info |
 |
H28(0.00); H104(0.00) | LDD2235 | [3] | |
|
m-APA Probe Info |
 |
H28(0.00); H104(0.00) | LDD2231 | [3] | |
|
IA-alkyne Probe Info |
 |
N.A. | LDD0032 | [4] | |
|
IPIAA_L Probe Info |
 |
C58(0.00); C16(0.00) | LDD0031 | [5] | |
|
SF Probe Info |
 |
N.A. | LDD0028 | [6] | |
|
Acrolein Probe Info |
 |
N.A. | LDD0217 | [7] | |
|
NAIA_5 Probe Info |
 |
C58(0.00); C16(0.00) | LDD2223 | [8] | |
|
HHS-465 Probe Info |
 |
N.A. | LDD2240 | [9] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C130 Probe Info |
 |
9.71 | LDD1812 | [10] | |
|
C159 Probe Info |
 |
9.71 | LDD1839 | [10] | |
|
C160 Probe Info |
 |
10.13 | LDD1840 | [10] | |
|
C161 Probe Info |
 |
12.47 | LDD1841 | [10] | |
|
VE-P Probe Info |
 |
N.A. | LDD0396 | [11] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0108 | Chloroacetamide | HeLa | C58(0.00); H173(0.00) | LDD0222 | [7] |
| LDCM0632 | CL-Sc | Hep-G2 | C16(0.31) | LDD2227 | [8] |
| LDCM0116 | HHS-0101 | DM93 | Y48(0.67) | LDD0264 | [2] |
| LDCM0117 | HHS-0201 | DM93 | Y48(0.78) | LDD0265 | [2] |
| LDCM0118 | HHS-0301 | DM93 | Y48(0.66) | LDD0266 | [2] |
| LDCM0119 | HHS-0401 | DM93 | Y48(0.76) | LDD0267 | [2] |
| LDCM0120 | HHS-0701 | DM93 | Y48(0.74) | LDD0268 | [2] |
| LDCM0107 | IAA | HeLa | C58(0.00); H173(0.00) | LDD0221 | [7] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Amyloid protein-binding protein 2 (APPBP2) | . | Q92624 | |||
References