General Information of Target

Target ID LDTP00251
Target Name Basic helix-loop-helix ARNT-like protein 1 (BMAL1)
Gene Name BMAL1
Gene ID 406
Synonyms
ARNTL; BHLHE5; MOP3; PASD3; Basic helix-loop-helix ARNT-like protein 1; Aryl hydrocarbon receptor nuclear translocator-like protein 1; Basic-helix-loop-helix-PAS protein MOP3; Brain and muscle ARNT-like 1; Class E basic helix-loop-helix protein 5; bHLHe5; Member of PAS protein 3; PAS domain-containing protein 3; bHLH-PAS protein JAP3
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGR
LEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQ
HMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKIL
NYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLC
SGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDE
DNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAI
LAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRW
FSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPT
VPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKI
LNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAM
AVIMSLLEADAGLGGPVDFSDLPWPL
Target Bioclass
Transcription factor
Subcellular location
Nucleus
Function
Transcriptional activator which forms a core component of the circadian clock. The circadian clock, an internal time-keeping system, regulates various physiological processes through the generation of approximately 24 hour circadian rhythms in gene expression, which are translated into rhythms in metabolism and behavior. It is derived from the Latin roots 'circa' (about) and 'diem' (day) and acts as an important regulator of a wide array of physiological functions including metabolism, sleep, body temperature, blood pressure, endocrine, immune, cardiovascular, and renal function. Consists of two major components: the central clock, residing in the suprachiasmatic nucleus (SCN) of the brain, and the peripheral clocks that are present in nearly every tissue and organ system. Both the central and peripheral clocks can be reset by environmental cues, also known as Zeitgebers (German for 'timegivers'). The predominant Zeitgeber for the central clock is light, which is sensed by retina and signals directly to the SCN. The central clock entrains the peripheral clocks through neuronal and hormonal signals, body temperature and feeding-related cues, aligning all clocks with the external light/dark cycle. Circadian rhythms allow an organism to achieve temporal homeostasis with its environment at the molecular level by regulating gene expression to create a peak of protein expression once every 24 hours to control when a particular physiological process is most active with respect to the solar day. Transcription and translation of core clock components (CLOCK, NPAS2, BMAL1, BMAL2, PER1, PER2, PER3, CRY1 and CRY2) plays a critical role in rhythm generation, whereas delays imposed by post-translational modifications (PTMs) are important for determining the period (tau) of the rhythms (tau refers to the period of a rhythm and is the length, in time, of one complete cycle). A diurnal rhythm is synchronized with the day/night cycle, while the ultradian and infradian rhythms have a period shorter and longer than 24 hours, respectively. Disruptions in the circadian rhythms contribute to the pathology of cardiovascular diseases, cancer, metabolic syndromes and aging. A transcription/translation feedback loop (TTFL) forms the core of the molecular circadian clock mechanism. Transcription factors, CLOCK or NPAS2 and BMAL1 or BMAL2, form the positive limb of the feedback loop, act in the form of a heterodimer and activate the transcription of core clock genes and clock-controlled genes (involved in key metabolic processes), harboring E-box elements (5'-CACGTG-3') within their promoters. The core clock genes: PER1/2/3 and CRY1/2 which are transcriptional repressors form the negative limb of the feedback loop and interact with the CLOCK|NPAS2-BMAL1|BMAL2 heterodimer inhibiting its activity and thereby negatively regulating their own expression. This heterodimer also activates nuclear receptors NR1D1/2 and RORA/B/G, which form a second feedback loop and which activate and repressBMAL1 transcription, respectively.BMAL1 positively regulates myogenesis and negatively regulates adipogenesis via the transcriptional control of the genes of the canonical Wnt signaling pathway. Plays a role in normal pancreatic beta-cell function; regulates glucose-stimulated insulin secretion via the regulation of antioxidant genes NFE2L2/NRF2 and its targets SESN2, PRDX3, CCLC and CCLM. Negatively regulates the mTORC1 signaling pathway; regulates the expression of MTOR and DEPTOR. Controls diurnal oscillations of Ly6C inflammatory monocytes; rhythmic recruitment of the PRC2 complex imparts diurnal variation to chemokine expression that is necessary to sustain Ly6C monocyte rhythms. Regulates the expression of HSD3B2, STAR, PTGS2, CYP11A1, CYP19A1 and LHCGR in the ovary and also the genes involved in hair growth. Plays an important role in adult hippocampal neurogenesis by regulating the timely entry of neural stem/progenitor cells (NSPCs) into the cell cycle and the number of cell divisions that take place prior to cell-cycle exit. Regulates the circadian expression of CIART and KLF11. The CLOCK-BMAL1 heterodimer regulates the circadian expression of SERPINE1/PAI1, VWF, B3, CCRN4L/NOC, NAMPT, DBP, MYOD1, PPARGC1A, PPARGC1B, SIRT1, GYS2, F7, NGFR, GNRHR, BHLHE40/DEC1, ATF4, MTA1, KLF10 and also genes implicated in glucose and lipid metabolism. Promotes rhythmic chromatin opening, regulating the DNA accessibility of other transcription factors. The NPAS2-BMAL1 heterodimer positively regulates the expression of MAOA, F7 and LDHA and modulates the circadian rhythm of daytime contrast sensitivity by regulating the rhythmic expression of adenylate cyclase type 1 (ADCY1) in the retina. The preferred binding motif for the CLOCK-BMAL1 heterodimer is 5'-CACGTGA-3', which contains a flanking adenine nucleotide at the 3-prime end of the canonical 6-nucleotide E-box sequence. CLOCK specifically binds to the half-site 5'-CAC-3', while BMAL1 binds to the half-site 5'-GTGA-3'. The CLOCK-BMAL1 heterodimer also recognizes the non-canonical E-box motifs 5'-AACGTGA-3' and 5'-CATGTGA-3'. Essential for the rhythmic interaction of CLOCK with ASS1 and plays a critical role in positively regulating CLOCK-mediated acetylation of ASS1. Plays a role in protecting against lethal sepsis by limiting the expression of immune checkpoint protein CD274 in macrophages in a PKM2-dependent manner. Regulates the diurnal rhythms of skeletal muscle metabolism via transcriptional activation of genes promoting triglyceride synthesis (DGAT2) and metabolic efficiency (COQ10B).; (Microbial infection) Regulates SARS coronavirus-2/SARS-CoV-2 entry and replication in lung epithelial cells probably through the post-transcriptional regulation of ACE2 and interferon-stimulated gene expression.
Uniprot ID
O00327
Ensemble ID
ENST00000389707.8
HGNC ID
HGNC:701

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C164(1.17)  LDD0531  [1]
NAIA_5
 Probe Info 
N.A.  LDD2224  [2]
IPM
 Probe Info 
C269(0.00); C240(0.00)  LDD0147  [3]
TFBX
 Probe Info 
N.A.  LDD0148  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0214  AC1 HCT 116 C164(1.17)  LDD0531  [1]
 LDCM0215  AC10 HEK-293T C253(1.10)  LDD1508  [4]
 LDCM0237  AC12 HEK-293T C253(1.14)  LDD1510  [4]
 LDCM0270  AC15 HEK-293T C253(1.13)  LDD1513  [4]
 LDCM0276  AC17 HCT 116 C164(1.17)  LDD0593  [1]
 LDCM0277  AC18 HCT 116 C164(1.01)  LDD0594  [1]
 LDCM0278  AC19 HCT 116 C164(1.04)  LDD0595  [1]
 LDCM0279  AC2 HCT 116 C164(0.97)  LDD0596  [1]
 LDCM0280  AC20 HCT 116 C164(1.23)  LDD0597  [1]
 LDCM0281  AC21 HCT 116 C164(1.13)  LDD0598  [1]
 LDCM0282  AC22 HCT 116 C164(1.10)  LDD0599  [1]
 LDCM0283  AC23 HCT 116 C164(1.12)  LDD0600  [1]
 LDCM0284  AC24 HCT 116 C164(1.29)  LDD0601  [1]
 LDCM0286  AC26 HEK-293T C253(1.05)  LDD1525  [4]
 LDCM0288  AC28 HEK-293T C253(1.07)  LDD1527  [4]
 LDCM0289  AC29 HEK-293T C253(1.04)  LDD1528  [4]
 LDCM0290  AC3 HCT 116 C164(1.04)  LDD0607  [1]
 LDCM0292  AC31 HEK-293T C253(1.13)  LDD1531  [4]
 LDCM0293  AC32 HEK-293T C403(0.83)  LDD1532  [4]
 LDCM0295  AC34 HEK-293T C253(1.09)  LDD1534  [4]
 LDCM0297  AC36 HEK-293T C253(1.05)  LDD1536  [4]
 LDCM0298  AC37 HEK-293T C253(1.07)  LDD1537  [4]
 LDCM0300  AC39 HEK-293T C253(1.12)  LDD1539  [4]
 LDCM0301  AC4 HCT 116 C164(1.32)  LDD0618  [1]
 LDCM0302  AC40 HEK-293T C403(0.95)  LDD1541  [4]
 LDCM0304  AC42 HEK-293T C253(1.16)  LDD1543  [4]
 LDCM0306  AC44 HEK-293T C253(1.08)  LDD1545  [4]
 LDCM0307  AC45 HEK-293T C253(1.08)  LDD1546  [4]
 LDCM0309  AC47 HEK-293T C253(1.22)  LDD1548  [4]
 LDCM0310  AC48 HEK-293T C403(0.91)  LDD1549  [4]
 LDCM0312  AC5 HCT 116 C164(1.28)  LDD0629  [1]
 LDCM0313  AC50 HEK-293T C253(1.02)  LDD1552  [4]
 LDCM0315  AC52 HEK-293T C253(1.12)  LDD1554  [4]
 LDCM0316  AC53 HEK-293T C253(0.99)  LDD1555  [4]
 LDCM0318  AC55 HEK-293T C253(1.17)  LDD1557  [4]
 LDCM0319  AC56 HEK-293T C403(0.98)  LDD1558  [4]
 LDCM0320  AC57 HCT 116 C164(0.86)  LDD0637  [1]
 LDCM0321  AC58 HCT 116 C164(0.73)  LDD0638  [1]
 LDCM0322  AC59 HCT 116 C164(0.66)  LDD0639  [1]
 LDCM0324  AC60 HCT 116 C164(0.62)  LDD0641  [1]
 LDCM0325  AC61 HCT 116 C164(0.72)  LDD0642  [1]
 LDCM0326  AC62 HCT 116 C164(0.66)  LDD0643  [1]
 LDCM0327  AC63 HCT 116 C164(0.51)  LDD0644  [1]
 LDCM0328  AC64 HCT 116 C164(0.62)  LDD0645  [1]
 LDCM0329  AC65 HCT 116 C164(0.59)  LDD0646  [1]
 LDCM0330  AC66 HCT 116 C164(0.55)  LDD0647  [1]
 LDCM0331  AC67 HCT 116 C164(0.63)  LDD0648  [1]
 LDCM0334  AC7 HEK-293T C253(1.04)  LDD1568  [4]
 LDCM0345  AC8 HEK-293T C403(0.96)  LDD1569  [4]
 LDCM0248  AKOS034007472 HEK-293T C253(1.11)  LDD1511  [4]
 LDCM0275  AKOS034007705 HEK-293T C403(0.95)  LDD1514  [4]
 LDCM0367  CL1 HCT 116 C164(0.90)  LDD0684  [1]
 LDCM0368  CL10 HCT 116 C164(0.87)  LDD0685  [1]
 LDCM0369  CL100 HCT 116 C164(1.27)  LDD0686  [1]
 LDCM0371  CL102 HEK-293T C269(0.95)  LDD1575  [4]
 LDCM0373  CL104 HEK-293T C403(1.07)  LDD1577  [4]
 LDCM0374  CL105 HCT 116 C164(1.08)  LDD0691  [1]
 LDCM0375  CL106 HCT 116 C164(1.12)  LDD0692  [1]
 LDCM0376  CL107 HCT 116 C164(1.33)  LDD0693  [1]
 LDCM0377  CL108 HCT 116 C164(1.54)  LDD0694  [1]
 LDCM0378  CL109 HCT 116 C164(1.32)  LDD0695  [1]
 LDCM0379  CL11 HCT 116 C164(0.91)  LDD0696  [1]
 LDCM0380  CL110 HCT 116 C164(1.13)  LDD0697  [1]
 LDCM0381  CL111 HCT 116 C164(1.13)  LDD0698  [1]
 LDCM0382  CL112 HEK-293T C403(0.94)  LDD1586  [4]
 LDCM0384  CL114 HEK-293T C269(0.93)  LDD1588  [4]
 LDCM0386  CL116 HEK-293T C403(1.04)  LDD1590  [4]
 LDCM0388  CL118 HEK-293T C269(0.97)  LDD1592  [4]
 LDCM0390  CL12 HCT 116 C164(1.06)  LDD0707  [1]
 LDCM0391  CL120 HEK-293T C403(1.02)  LDD1595  [4]
 LDCM0393  CL122 HEK-293T C269(0.94)  LDD1597  [4]
 LDCM0395  CL124 HEK-293T C403(1.02)  LDD1599  [4]
 LDCM0396  CL125 HCT 116 C164(0.78)  LDD0713  [1]
 LDCM0397  CL126 HCT 116 C164(0.74)  LDD0714  [1]
 LDCM0398  CL127 HCT 116 C164(0.62)  LDD0715  [1]
 LDCM0399  CL128 HCT 116 C164(0.89)  LDD0716  [1]
 LDCM0400  CL13 HCT 116 C164(1.15)  LDD0717  [1]
 LDCM0401  CL14 HCT 116 C164(1.10)  LDD0718  [1]
 LDCM0402  CL15 HCT 116 C164(1.20)  LDD0719  [1]
 LDCM0403  CL16 HEK-293T C403(1.06)  LDD1607  [4]
 LDCM0405  CL18 HEK-293T C253(0.83)  LDD1609  [4]
 LDCM0407  CL2 HCT 116 C164(1.21)  LDD0724  [1]
 LDCM0408  CL20 HEK-293T C253(0.83)  LDD1612  [4]
 LDCM0409  CL21 HEK-293T C253(0.60)  LDD1613  [4]
 LDCM0411  CL23 HEK-293T C253(0.86)  LDD1615  [4]
 LDCM0412  CL24 HEK-293T C403(0.91)  LDD1616  [4]
 LDCM0414  CL26 HEK-293T C269(0.95)  LDD1618  [4]
 LDCM0416  CL28 HEK-293T C403(1.00)  LDD1620  [4]
 LDCM0418  CL3 HCT 116 C164(0.91)  LDD0735  [1]
 LDCM0419  CL30 HEK-293T C253(0.99)  LDD1623  [4]
 LDCM0420  CL31 HCT 116 C164(1.06)  LDD0737  [1]
 LDCM0421  CL32 HCT 116 C164(1.02)  LDD0738  [1]
 LDCM0422  CL33 HCT 116 C164(0.90)  LDD0739  [1]
 LDCM0423  CL34 HCT 116 C164(1.08)  LDD0740  [1]
 LDCM0424  CL35 HCT 116 C164(0.85)  LDD0741  [1]
 LDCM0425  CL36 HCT 116 C164(0.91)  LDD0742  [1]
 LDCM0426  CL37 HCT 116 C164(1.04)  LDD0743  [1]
 LDCM0428  CL39 HCT 116 C164(1.15)  LDD0745  [1]
 LDCM0429  CL4 HCT 116 C164(0.97)  LDD0746  [1]
 LDCM0430  CL40 HCT 116 C164(0.93)  LDD0747  [1]
 LDCM0431  CL41 HCT 116 C164(1.03)  LDD0748  [1]
 LDCM0432  CL42 HCT 116 C164(0.99)  LDD0749  [1]
 LDCM0433  CL43 HCT 116 C164(1.07)  LDD0750  [1]
 LDCM0434  CL44 HCT 116 C164(1.06)  LDD0751  [1]
 LDCM0435  CL45 HCT 116 C164(1.01)  LDD0752  [1]
 LDCM0437  CL47 HEK-293T C253(0.87)  LDD1641  [4]
 LDCM0438  CL48 HEK-293T C403(0.93)  LDD1642  [4]
 LDCM0440  CL5 HCT 116 C164(1.02)  LDD0757  [1]
 LDCM0441  CL50 HEK-293T C269(1.01)  LDD1645  [4]
 LDCM0443  CL52 HEK-293T C403(1.21)  LDD1646  [4]
 LDCM0445  CL54 HEK-293T C253(1.13)  LDD1648  [4]
 LDCM0447  CL56 HEK-293T C253(1.09)  LDD1650  [4]
 LDCM0448  CL57 HEK-293T C253(1.11)  LDD1651  [4]
 LDCM0450  CL59 HEK-293T C253(1.14)  LDD1653  [4]
 LDCM0451  CL6 HCT 116 C164(1.17)  LDD0768  [1]
 LDCM0452  CL60 HEK-293T C403(0.98)  LDD1655  [4]
 LDCM0453  CL61 HCT 116 C164(1.13)  LDD0770  [1]
 LDCM0454  CL62 HCT 116 C164(1.14)  LDD0771  [1]
 LDCM0455  CL63 HCT 116 C164(1.09)  LDD0772  [1]
 LDCM0456  CL64 HCT 116 C164(1.21)  LDD0773  [1]
 LDCM0457  CL65 HCT 116 C164(1.15)  LDD0774  [1]
 LDCM0458  CL66 HCT 116 C164(1.07)  LDD0775  [1]
 LDCM0459  CL67 HCT 116 C164(0.98)  LDD0776  [1]
 LDCM0460  CL68 HCT 116 C164(0.86)  LDD0777  [1]
 LDCM0461  CL69 HCT 116 C164(1.07)  LDD0778  [1]
 LDCM0462  CL7 HCT 116 C164(1.16)  LDD0779  [1]
 LDCM0463  CL70 HCT 116 C164(1.01)  LDD0780  [1]
 LDCM0464  CL71 HCT 116 C164(0.95)  LDD0781  [1]
 LDCM0465  CL72 HCT 116 C164(1.08)  LDD0782  [1]
 LDCM0466  CL73 HCT 116 C164(1.11)  LDD0783  [1]
 LDCM0467  CL74 HCT 116 C164(0.93)  LDD0784  [1]
 LDCM0469  CL76 HEK-293T C403(1.10)  LDD1672  [4]
 LDCM0471  CL78 HEK-293T C253(1.03)  LDD1674  [4]
 LDCM0473  CL8 HCT 116 C164(1.17)  LDD0790  [1]
 LDCM0474  CL80 HEK-293T C253(1.08)  LDD1677  [4]
 LDCM0475  CL81 HEK-293T C253(1.15)  LDD1678  [4]
 LDCM0477  CL83 HEK-293T C253(1.00)  LDD1680  [4]
 LDCM0478  CL84 HEK-293T C403(0.90)  LDD1681  [4]
 LDCM0480  CL86 HEK-293T C269(1.03)  LDD1683  [4]
 LDCM0482  CL88 HEK-293T C403(1.12)  LDD1685  [4]
 LDCM0484  CL9 HCT 116 C164(1.06)  LDD0801  [1]
 LDCM0485  CL90 HEK-293T C253(1.06)  LDD1688  [4]
 LDCM0486  CL91 HCT 116 C164(0.73)  LDD0803  [1]
 LDCM0487  CL92 HCT 116 C164(0.86)  LDD0804  [1]
 LDCM0488  CL93 HCT 116 C164(1.02)  LDD0805  [1]
 LDCM0489  CL94 HCT 116 C164(1.28)  LDD0806  [1]
 LDCM0490  CL95 HCT 116 C164(0.94)  LDD0807  [1]
 LDCM0491  CL96 HCT 116 C164(0.82)  LDD0808  [1]
 LDCM0492  CL97 HCT 116 C164(0.78)  LDD0809  [1]
 LDCM0493  CL98 HCT 116 C164(0.89)  LDD0810  [1]
 LDCM0494  CL99 HCT 116 C164(1.11)  LDD0811  [1]
 LDCM0468  Fragment33 HCT 116 C164(1.12)  LDD0785  [1]
 LDCM0427  Fragment51 HCT 116 C164(0.98)  LDD0744  [1]
 LDCM0022  KB02 A-549 C403(1.38)  LDD2260  [5]
 LDCM0023  KB03 A-549 C403(1.40)  LDD2677  [5]
 LDCM0024  KB05 RL95-2 C403(4.08)  LDD3409  [5]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
2-oxoadipate dehydrogenase complex component E1 (DHTKD1) Alpha-ketoglutarate dehydrogenase family Q96HY7
Antizyme inhibitor 1 (AZIN1) Orn/Lys/Arg decarboxylase class-II family O14977
Circadian locomoter output cycles protein kaput (CLOCK) . O15516
Trafficking protein particle complex subunit 12 (TRAPPC12) . Q8WVT3
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Endothelial PAS domain-containing protein 1 (EPAS1) . Q99814
Neuronal PAS domain-containing protein 2 (NPAS2) . Q99743
Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger MYND domain-containing protein 12 (ZMYND12) . Q9H0C1

References

1 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.
2 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
3 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
4 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
5 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840