Details of the Target

General Information of Target

Target ID LDTP12981
Target Name Proton-transporting V-type ATPase complex assembly regulator TMEM9 (TMEM9)
Gene Name TMEM9
Gene ID 252839
Synonyms
DERP4; TMEM9A; Proton-transporting V-type ATPase complex assembly regulator TMEM9; v-ATPase assembly regulator TMEM9; Dermal papilla-derived protein 4; Transmembrane protein 9; Protein TMEM9
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQG
VPYTVLVDEESQREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDIC
GKAFKRASHLARHHSIHLAGGGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPHCPR
RFMEQNTLQKHTRWKHP
Target Bioclass
Transporter and channel
Family
TMEM9 family
Subcellular location
Lysosome membrane
Function
Transmembrane protein that binds to and facilitates the assembly of lysosomal proton-transporting V-type ATPase (v-ATPase), resulting in enhanced lysosomal acidification and trafficking. By bringing the v-ATPase accessory protein ATP6AP2 and the v-ATPase subunit ATP6V0D1 together, allows v-ATPase complex formation and activation. TMEM9-controlled vesicular acidification induces hyperactivation of Wnt/beta-catenin signaling, involved in development, tissue homeostasis and tissue regeneration, through lysosomal degradation of adenomatous polyposis coli/APC. In the liver, involved in hepatic regeneration.
Uniprot ID
Q9P0T7
Ensemble ID
ENST00000367330.6
HGNC ID
HGNC:18823

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
Probe 1
 Probe Info  		Y122(6.57)  LDD3495  [1]
FBPP2
 Probe Info  		4.29  LDD0054  [2]
Acrolein
 Probe Info  		N.A.  LDD0227  [3]
DBIA
 Probe Info  		C33(1.06)  LDD1507  [4]
PAL-AfBPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C106
 Probe Info  		16.11  LDD1793  [5]
C310
 Probe Info  		24.08  LDD1977  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0214  AC1 HEK-293T C33(1.06)  LDD1507  [4]
 LDCM0259  AC14 HEK-293T C33(1.00)  LDD1512  [4]
 LDCM0276  AC17 HEK-293T C33(1.01)  LDD1515  [4]
 LDCM0282  AC22 HEK-293T C33(0.97)  LDD1521  [4]
 LDCM0285  AC25 HEK-293T C33(1.03)  LDD1524  [4]
 LDCM0291  AC30 HEK-293T C33(0.90)  LDD1530  [4]
 LDCM0294  AC33 HEK-293T C33(0.91)  LDD1533  [4]
 LDCM0299  AC38 HEK-293T C33(0.97)  LDD1538  [4]
 LDCM0303  AC41 HEK-293T C33(1.07)  LDD1542  [4]
 LDCM0308  AC46 HEK-293T C33(0.82)  LDD1547  [4]
 LDCM0311  AC49 HEK-293T C33(1.00)  LDD1550  [4]
 LDCM0317  AC54 HEK-293T C33(1.01)  LDD1556  [4]
 LDCM0320  AC57 HEK-293T C33(0.99)  LDD1559  [4]
 LDCM0323  AC6 HEK-293T C33(0.99)  LDD1562  [4]
 LDCM0326  AC62 HEK-293T C33(0.94)  LDD1565  [4]
 LDCM0356  AKOS034007680 HEK-293T C33(0.98)  LDD1570  [4]
 LDCM0368  CL10 HEK-293T C33(1.11)  LDD1572  [4]
 LDCM0404  CL17 HEK-293T C33(0.93)  LDD1608  [4]
 LDCM0410  CL22 HEK-293T C33(1.02)  LDD1614  [4]
 LDCM0417  CL29 HEK-293T C33(0.90)  LDD1621  [4]
 LDCM0423  CL34 HEK-293T C33(1.11)  LDD1627  [4]
 LDCM0431  CL41 HEK-293T C33(0.98)  LDD1635  [4]
 LDCM0436  CL46 HEK-293T C33(1.16)  LDD1640  [4]
 LDCM0440  CL5 HEK-293T C33(1.10)  LDD1644  [4]
 LDCM0444  CL53 HEK-293T C33(1.03)  LDD1647  [4]
 LDCM0449  CL58 HEK-293T C33(1.13)  LDD1652  [4]
 LDCM0457  CL65 HEK-293T C33(0.89)  LDD1660  [4]
 LDCM0463  CL70 HEK-293T C33(0.93)  LDD1666  [4]
 LDCM0470  CL77 HEK-293T C33(1.01)  LDD1673  [4]
 LDCM0476  CL82 HEK-293T C33(1.07)  LDD1679  [4]
 LDCM0483  CL89 HEK-293T C33(0.97)  LDD1686  [4]
 LDCM0489  CL94 HEK-293T C33(1.08)  LDD1692  [4]
 LDCM0109  NEM HeLa N.A.  LDD0227  [3]
 LDCM0008  Tranylcypromine SH-SY5Y 4.29  LDD0054  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
V-type proton ATPase 16 kDa proteolipid subunit c (ATP6V0C) V-ATPase proteolipid subunit family P27449
Transporter and channel
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Proton-coupled zinc antiporter SLC30A8 (SLC30A8) Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family Q8IWU4
Claudin-1 (CLDN1) Claudin family O95832
Syntaxin-6 (STX6) Syntaxin family O43752
Translocator protein (TSPO) TspO/BZRP family P30536
Phospholipid transfer protein C2CD2L (C2CD2L) . O14523
Transmembrane protein 60 (TMEM60) . Q9H2L4
Other
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Claudin-10 (CLDN10) Claudin family P78369
Ninjurin-2 (NINJ2) Ninjurin family Q9NZG7
Epithelial membrane protein 1 (EMP1) PMP-22/EMP/MP20 family P54849
Transmembrane protein 140 (TMEM140) . Q9NV12

References

1 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
2 Tranylcypromine specificity for monoamine oxidase is limited by promiscuous protein labelling and lysosomal trapping. RSC Chem Biol. 2020 Aug 12;1(4):209-213. doi: 10.1039/d0cb00048e. eCollection 2020 Oct 1.
Mass spectrometry data entry: PXD018580
3 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
4 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
5 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587