Details of the Target
General Information of Target
| Target ID | LDTP12184 | |||||
|---|---|---|---|---|---|---|
| Target Name | Beta-parvin (PARVB) | |||||
| Gene Name | PARVB | |||||
| Gene ID | 29780 | |||||
| Synonyms |
Beta-parvin; Affixin |
|||||
| 3D Structure | ||||||
| Sequence |
MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLP
EHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLE EWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLV EQLTEYSTDKDEPPKDVFDELFKLAPEKVNAVKEAIVNFVNQKLDRLGLSVQNLDTQFAD GVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVSPEDIVNK DAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Parvin family
|
|||||
| Subcellular location |
Cell junction, focal adhesion
|
|||||
| Function |
Adapter protein that plays a role in integrin signaling via ILK and in activation of the GTPases CDC42 and RAC1 by guanine exchange factors, such as ARHGEF6. Is involved in the reorganization of the actin cytoskeleton and formation of lamellipodia. Plays a role in cell adhesion, cell spreading, establishment or maintenance of cell polarity, and cell migration.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
HHS-482 Probe Info |
![]() |
Y354(1.27) | LDD0285 | [1] | |
|
HHS-475 Probe Info |
![]() |
Y354(0.89) | LDD0264 | [2] | |
|
ATP probe Probe Info |
![]() |
K359(0.00); K361(0.00) | LDD0199 | [3] | |
|
SF Probe Info |
![]() |
N.A. | LDD0028 | [4] | |
|
HHS-465 Probe Info |
![]() |
N.A. | LDD2240 | [5] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0116 | HHS-0101 | DM93 | Y354(0.89) | LDD0264 | [2] |
| LDCM0117 | HHS-0201 | DM93 | Y354(0.87) | LDD0265 | [2] |
| LDCM0118 | HHS-0301 | DM93 | Y354(0.82) | LDD0266 | [2] |
| LDCM0119 | HHS-0401 | DM93 | Y354(0.80) | LDD0267 | [2] |
| LDCM0120 | HHS-0701 | DM93 | Y354(0.93) | LDD0268 | [2] |
| LDCM0123 | JWB131 | DM93 | Y354(1.27) | LDD0285 | [1] |
| LDCM0124 | JWB142 | DM93 | Y354(2.38) | LDD0286 | [1] |
| LDCM0126 | JWB150 | DM93 | Y354(3.64) | LDD0288 | [1] |
| LDCM0127 | JWB152 | DM93 | Y354(0.34) | LDD0289 | [1] |
| LDCM0128 | JWB198 | DM93 | Y354(0.22) | LDD0290 | [1] |
| LDCM0129 | JWB202 | DM93 | Y354(1.81) | LDD0291 | [1] |
| LDCM0130 | JWB211 | DM93 | Y354(0.69) | LDD0292 | [1] |
References





