Details of the Target
General Information of Target
| Target ID | LDTP10207 | |||||
|---|---|---|---|---|---|---|
| Target Name | Mitochondrial import inner membrane translocase subunit TIM14 (DNAJC19) | |||||
| Gene Name | DNAJC19 | |||||
| Gene ID | 131118 | |||||
| Synonyms |
TIM14; TIMM14; Mitochondrial import inner membrane translocase subunit TIM14; DnaJ homolog subfamily C member 19 |
|||||
| 3D Structure | ||||||
| Sequence |
MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKL
QIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVL VGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEI TIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
TIM14 family
|
|||||
| Subcellular location |
Mitochondrion inner membrane
|
|||||
| Function |
Mitochondrial co-chaperone which forms a complex with prohibitins to regulate cardiolipin remodeling. May be a component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K93(5.92) | LDD0277 | [1] | |
|
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [2] | |
|
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [2] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [3] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C094 Probe Info |
![]() |
24.08 | LDD1785 | [4] | |
|
C231 Probe Info |
![]() |
11.55 | LDD1904 | [4] | |
|
C235 Probe Info |
![]() |
19.97 | LDD1908 | [4] | |
|
C388 Probe Info |
![]() |
52.35 | LDD2047 | [4] | |
Competitor(s) Related to This Target
References








