Details of the Target

General Information of Target

Target ID LDTP10003
Target Name Myeloid-derived growth factor (MYDGF)
Gene Name MYDGF
Gene ID 56005
Synonyms
C19orf10; Myeloid-derived growth factor; MYDGF
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MVRFKHRYLLCELVSDDPRCRLSLDDRVLSSLVRDTIARVHGTFGAAACSIGFAVRYLNA
YTGIVLLRCRKEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRR
QLLILLQNCTDEGEREAIQKSVTRSCLLEEEEESGEEAAEAME
Target Bioclass
Other
Family
MYDGF family
Subcellular location
Secreted
Function
Bone marrow-derived monocyte and paracrine-acting protein that promotes cardiac myocyte survival and adaptive angiogenesis for cardiac protection and/or repair after myocardial infarction (MI). Stimulates endothelial cell proliferation through a MAPK1/3-, STAT3- and CCND1-mediated signaling pathway. Inhibits cardiac myocyte apoptosis in a PI3K/AKT-dependent signaling pathway. Involved in endothelial cell proliferation and angiogenesis.
Uniprot ID
Q969H8
Ensemble ID
ENST00000262947.8
HGNC ID
HGNC:16948

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 14 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
SAA-alkyne
 Probe Info  		1.17  LDD0252  [1]
TH211
 Probe Info  		Y102(20.00); Y123(20.00)  LDD0260  [2]
STPyne
 Probe Info  		K156(1.64); K161(7.94); K167(1.18)  LDD0277  [3]
Probe 1
 Probe Info  		Y119(16.06)  LDD3495  [4]
m-APA
 Probe Info  		11.45  LDD0403  [5]
HHS-482
 Probe Info  		Y102(2.81)  LDD0285  [6]
HHS-475
 Probe Info  		Y119(0.85); Y104(0.95); Y102(0.96)  LDD0264  [7]
HHS-465
 Probe Info  		Y102(3.98)  LDD2237  [8]
5E-2FA
 Probe Info  		H53(0.00); H49(0.00); H150(0.00)  LDD2235  [9]
ATP probe
 Probe Info  		N.A.  LDD0035  [10]
NHS
 Probe Info  		N.A.  LDD0010  [11]
SF
 Probe Info  		Y104(0.00); Y102(0.00)  LDD0028  [12]
Acrolein
 Probe Info  		H49(0.00); H150(0.00)  LDD0217  [13]
AOyne
 Probe Info  		10.00  LDD0443  [14]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0156  Aniline NCI-H1299 11.45  LDD0403  [5]
 LDCM0108  Chloroacetamide HeLa H150(0.00); H49(0.00); H53(0.00)  LDD0222  [13]
 LDCM0116  HHS-0101 DM93 Y119(0.85); Y104(0.95); Y102(0.96)  LDD0264  [7]
 LDCM0117  HHS-0201 DM93 Y119(0.55); Y104(0.81); Y102(0.82)  LDD0265  [7]
 LDCM0118  HHS-0301 DM93 Y119(0.76); Y104(0.93); Y102(0.93)  LDD0266  [7]
 LDCM0119  HHS-0401 DM93 Y119(0.73); Y104(0.86); Y102(0.89)  LDD0267  [7]
 LDCM0120  HHS-0701 DM93 Y119(0.37); Y104(0.78); Y102(0.81)  LDD0268  [7]
 LDCM0107  IAA HeLa H49(0.00); H53(0.00)  LDD0221  [13]
 LDCM0123  JWB131 DM93 Y102(2.81)  LDD0285  [6]
 LDCM0124  JWB142 DM93 Y102(2.64)  LDD0286  [6]
 LDCM0125  JWB146 DM93 Y102(1.92)  LDD0287  [6]
 LDCM0127  JWB152 DM93 Y102(6.78)  LDD0289  [6]
 LDCM0129  JWB202 DM93 Y102(2.15)  LDD0291  [6]
 LDCM0130  JWB211 DM93 Y102(3.24)  LDD0292  [6]
 LDCM0109  NEM HeLa H49(0.00); H150(0.00)  LDD0223  [13]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Eukaryotic translation initiation factor 3 subunit F (EIF3F) EIF-3 subunit F family O00303
Acyl-coenzyme A thioesterase 13 (ACOT13) Thioesterase PaaI family Q9NPJ3
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Neuron-specific calcium-binding protein hippocalcin (HPCA) Recoverin family P84074
Other
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Neutrophil gelatinase-associated lipocalin (LCN2) Lipocalin family P80188
DNA damage-inducible transcript 4-like protein (DDIT4L) DDIT4 family Q96D03
LIM domain-binding protein 2 (LDB2) LDB family O43679
Hippocalcin-like protein 1 (HPCAL1) Recoverin family P37235
Neurocalcin-delta (NCALD) Recoverin family P61601
Small glutamine-rich tetratricopeptide repeat-containing protein alpha (SGTA) SGT family O43765
Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB) SGT family Q96EQ0
Ubiquilin-1 (UBQLN1) . Q9UMX0
Ubiquilin-2 (UBQLN2) . Q9UHD9

References

1 Chemoproteomics and Phosphoproteomics Profiling Reveals Salvianolic Acid A as a Covalent Inhibitor of mTORC1. J Proteome Res. 2023 Jul 7;22(7):2450-2459. doi: 10.1021/acs.jproteome.3c00188. Epub 2023 Jun 22.
2 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
3 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
4 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
5 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
6 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
7 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
8 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
9 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
10 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096
11 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
12 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
13 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
14 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.