General Information of Target

Target ID LDTP08919
Target Name COMM domain-containing protein 1 (COMMD1)
Gene Name COMMD1
Gene ID 150684
Synonyms
C2orf5; MURR1; COMM domain-containing protein 1; Protein Murr1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILK
SIASADMDFNQLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLR
GLSWRVDGKSQSRHSAQIHTPVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEE
SISTLISQPN
Target Bioclass
Other
Subcellular location
Nucleus
Function
Proposed scaffold protein that is implicated in diverse physiological processes and whose function may be in part linked to its ability to regulate ubiquitination of specific cellular proteins. Can modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes by displacing CAND1; in vitro promotes CRL E3 activity and dissociates CAND1 from CUL1 and CUL2. Promotes ubiquitination of NF-kappa-B subunit RELA and its subsequent proteasomal degradation. Down-regulates NF-kappa-B activity. Involved in the regulation of membrane expression and ubiquitination of SLC12A2. Modulates Na(+) transport in epithelial cells by regulation of apical cell surface expression of amiloride-sensitive sodium channel (ENaC) subunits and by promoting their ubiquitination presumably involving NEDD4L. Promotes the localization of SCNN1D to recycling endosomes. Promotes CFTR cell surface expression through regulation of its ubiquitination. Down-regulates SOD1 activity by interfering with its homodimerization. Plays a role in copper ion homeostasis. Involved in copper-dependent ATP7A trafficking between the trans-Golgi network and vesicles in the cell periphery; the function is proposed to depend on its association within the CCC complex and cooperation with the WASH complex on early endosomes. Can bind one copper ion per monomer. May function to facilitate biliary copper excretion within hepatocytes. Binds to phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). Involved in the regulation of HIF1A-mediated transcription; competes with ARNT/Hif-1-beta for binding to HIF1A resulting in decreased DNA binding and impaired transcriptional activation by HIF-1. Negatively regulates neuroblastoma G1/S phase cell cycle progression and cell proliferation by stimulating ubiquitination of NF-kappa-B subunit RELA and NF-kappa-B degradation in a FAM107A- and actin-dependent manner.
Uniprot ID
Q8N668
Ensemble ID
ENST00000311832.6
HGNC ID
HGNC:23024

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
IGROV1 Insertion: p.P11TfsTer50 .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info 
K82(7.69)  LDD0277  [1]
DBIA
 Probe Info 
C160(1.00)  LDD1492  [2]
IA-alkyne
 Probe Info 
N.A.  LDD2241  [3]
PAL-AfBPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C218
 Probe Info 
34.30  LDD1892  [4]
C403
 Probe Info 
16.91  LDD2061  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0214  AC1 HEK-293T C160(1.02)  LDD1507  [2]
 LDCM0237  AC12 HEK-293T C160(0.92)  LDD1510  [2]
 LDCM0270  AC15 HEK-293T C160(1.02)  LDD1513  [2]
 LDCM0276  AC17 HEK-293T C160(0.90)  LDD1515  [2]
 LDCM0280  AC20 HEK-293T C160(0.99)  LDD1519  [2]
 LDCM0283  AC23 HEK-293T C160(1.05)  LDD1522  [2]
 LDCM0284  AC24 HEK-293T C160(1.14)  LDD1523  [2]
 LDCM0285  AC25 HEK-293T C160(0.98)  LDD1524  [2]
 LDCM0288  AC28 HEK-293T C160(0.89)  LDD1527  [2]
 LDCM0292  AC31 HEK-293T C160(1.05)  LDD1531  [2]
 LDCM0293  AC32 HEK-293T C160(1.21)  LDD1532  [2]
 LDCM0294  AC33 HEK-293T C160(1.05)  LDD1533  [2]
 LDCM0297  AC36 HEK-293T C160(0.93)  LDD1536  [2]
 LDCM0300  AC39 HEK-293T C160(0.98)  LDD1539  [2]
 LDCM0301  AC4 HEK-293T C160(0.87)  LDD1540  [2]
 LDCM0302  AC40 HEK-293T C160(1.25)  LDD1541  [2]
 LDCM0303  AC41 HEK-293T C160(0.96)  LDD1542  [2]
 LDCM0306  AC44 HEK-293T C160(0.93)  LDD1545  [2]
 LDCM0309  AC47 HEK-293T C160(1.06)  LDD1548  [2]
 LDCM0310  AC48 HEK-293T C160(1.12)  LDD1549  [2]
 LDCM0311  AC49 HEK-293T C160(1.12)  LDD1550  [2]
 LDCM0315  AC52 HEK-293T C160(0.95)  LDD1554  [2]
 LDCM0318  AC55 HEK-293T C160(1.05)  LDD1557  [2]
 LDCM0319  AC56 HEK-293T C160(1.15)  LDD1558  [2]
 LDCM0320  AC57 HEK-293T C160(0.99)  LDD1559  [2]
 LDCM0324  AC60 HEK-293T C160(1.01)  LDD1563  [2]
 LDCM0327  AC63 HEK-293T C160(0.97)  LDD1566  [2]
 LDCM0328  AC64 HEK-293T C160(1.26)  LDD1567  [2]
 LDCM0334  AC7 HEK-293T C160(1.01)  LDD1568  [2]
 LDCM0345  AC8 HEK-293T C160(1.19)  LDD1569  [2]
 LDCM0356  AKOS034007680 HEK-293T C160(0.97)  LDD1570  [2]
 LDCM0275  AKOS034007705 HEK-293T C160(1.08)  LDD1514  [2]
 LDCM0367  CL1 HEK-293T C160(1.08)  LDD1571  [2]
 LDCM0370  CL101 HEK-293T C160(1.14)  LDD1574  [2]
 LDCM0374  CL105 HEK-293T C160(0.91)  LDD1578  [2]
 LDCM0378  CL109 HEK-293T C160(0.97)  LDD1582  [2]
 LDCM0379  CL11 HEK-293T C160(1.08)  LDD1583  [2]
 LDCM0383  CL113 HEK-293T C160(1.03)  LDD1587  [2]
 LDCM0387  CL117 HEK-293T C160(0.86)  LDD1591  [2]
 LDCM0390  CL12 HEK-293T C160(1.10)  LDD1594  [2]
 LDCM0392  CL121 HEK-293T C160(1.03)  LDD1596  [2]
 LDCM0396  CL125 HEK-293T C160(1.06)  LDD1600  [2]
 LDCM0400  CL13 HEK-293T C160(0.93)  LDD1604  [2]
 LDCM0404  CL17 HEK-293T C160(0.99)  LDD1608  [2]
 LDCM0408  CL20 HEK-293T C160(0.94)  LDD1612  [2]
 LDCM0411  CL23 HEK-293T C160(0.97)  LDD1615  [2]
 LDCM0412  CL24 HEK-293T C160(1.19)  LDD1616  [2]
 LDCM0413  CL25 HEK-293T C160(0.84)  LDD1617  [2]
 LDCM0417  CL29 HEK-293T C160(1.16)  LDD1621  [2]
 LDCM0421  CL32 HEK-293T C160(0.90)  LDD1625  [2]
 LDCM0424  CL35 HEK-293T C160(1.00)  LDD1628  [2]
 LDCM0425  CL36 HEK-293T C160(1.03)  LDD1629  [2]
 LDCM0426  CL37 HEK-293T C160(1.03)  LDD1630  [2]
 LDCM0431  CL41 HEK-293T C160(0.79)  LDD1635  [2]
 LDCM0434  CL44 HEK-293T C160(0.92)  LDD1638  [2]
 LDCM0437  CL47 HEK-293T C160(1.09)  LDD1641  [2]
 LDCM0438  CL48 HEK-293T C160(1.17)  LDD1642  [2]
 LDCM0439  CL49 HEK-293T C160(1.06)  LDD1643  [2]
 LDCM0440  CL5 HEK-293T C160(1.01)  LDD1644  [2]
 LDCM0444  CL53 HEK-293T C160(1.01)  LDD1647  [2]
 LDCM0447  CL56 HEK-293T C160(0.96)  LDD1650  [2]
 LDCM0450  CL59 HEK-293T C160(1.10)  LDD1653  [2]
 LDCM0452  CL60 HEK-293T C160(1.46)  LDD1655  [2]
 LDCM0453  CL61 HEK-293T C160(1.07)  LDD1656  [2]
 LDCM0457  CL65 HEK-293T C160(1.03)  LDD1660  [2]
 LDCM0460  CL68 HEK-293T C160(1.05)  LDD1663  [2]
 LDCM0464  CL71 HEK-293T C160(1.01)  LDD1667  [2]
 LDCM0465  CL72 HEK-293T C160(1.05)  LDD1668  [2]
 LDCM0466  CL73 HEK-293T C160(0.93)  LDD1669  [2]
 LDCM0470  CL77 HEK-293T C160(0.94)  LDD1673  [2]
 LDCM0473  CL8 HEK-293T C160(0.84)  LDD1676  [2]
 LDCM0474  CL80 HEK-293T C160(1.05)  LDD1677  [2]
 LDCM0477  CL83 HEK-293T C160(1.08)  LDD1680  [2]
 LDCM0478  CL84 HEK-293T C160(1.01)  LDD1681  [2]
 LDCM0479  CL85 HEK-293T C160(1.01)  LDD1682  [2]
 LDCM0483  CL89 HEK-293T C160(0.95)  LDD1686  [2]
 LDCM0487  CL92 HEK-293T C160(1.01)  LDD1690  [2]
 LDCM0490  CL95 HEK-293T C160(1.00)  LDD1693  [2]
 LDCM0491  CL96 HEK-293T C160(1.41)  LDD1694  [2]
 LDCM0492  CL97 HEK-293T C160(1.12)  LDD1695  [2]
 LDCM0022  KB02 HEK-293T C160(1.00)  LDD1492  [2]
 LDCM0023  KB03 HEK-293T C160(1.05)  LDD1497  [2]
 LDCM0024  KB05 HEK-293T C160(0.80)  LDD1502  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Copper-transporting ATPase 2 (ATP7B) Cation transport ATPase (P-type) (TC 3.A.3) family P35670
Cullin-2 (CUL2) Cullin family Q13617
Uracil phosphoribosyltransferase homolog (UPRT) UPRTase family Q96BW1
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Amiloride-sensitive sodium channel subunit delta (SCNN1D) Amiloride-sensitive sodium channel (TC 1.A.6) family P51172
Coiled-coil domain-containing protein 22 (CCDC22) CCDC22 family O60826
Coiled-coil domain-containing protein 93 (CCDC93) CCDC93 family Q567U6
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
High mobility group protein B2 (HMGB2) HMGB family P26583
NF-kappa-B inhibitor alpha (NFKBIA) NF-kappa-B inhibitor family P25963
Proto-oncogene c-Rel (REL) . Q04864
Transcription factor p65 (RELA) . Q04206
Transcription factor RelB (RELB) . Q01201
Other
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Elongin-C (ELOC) SKP1 family Q15369
Suppressor of cytokine signaling 1 (SOCS1) SOCS1 family O15524
Transcription elongation factor A protein-like 8 (TCEAL8) TFS-II family Q8IYN2
COMM domain-containing protein 1 (COMMD1) . Q8N668
COMM domain-containing protein 10 (COMMD10) . Q9Y6G5
COMM domain-containing protein 2 (COMMD2) . Q86X83
COMM domain-containing protein 3 (COMMD3) . Q9UBI1
COMM domain-containing protein 4 (COMMD4) . Q9H0A8
COMM domain-containing protein 5 (COMMD5) . Q9GZQ3
COMM domain-containing protein 6 (COMMD6) . Q7Z4G1
COMM domain-containing protein 8 (COMMD8) . Q9NX08

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
3 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
4 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587