Details of the Target
General Information of Target
Target ID | LDTP08153 | |||||
---|---|---|---|---|---|---|
Target Name | Transmembrane emp24 domain-containing protein 4 (TMED4) | |||||
Gene Name | TMED4 | |||||
Gene ID | 222068 | |||||
Synonyms |
ERS25; Transmembrane emp24 domain-containing protein 4; Endoplasmic reticulum stress-response protein 25; ERS25; GMP25iso; Putative NF-kappa-B-activating protein 156; p24 family protein alpha-3; p24alpha3
|
|||||
3D Structure | ||||||
Sequence |
MAGVGAGPLRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRTQM
WDKQKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTR MALFAGGKLRVHLDIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYR EERFRLTSESTNQRVLWWSIAQTVILILTGIWQMRHLKSFFEAKKLV |
|||||
Target Bioclass |
Other
|
|||||
Family |
EMP24/GP25L family
|
|||||
Subcellular location |
Endoplasmic reticulum membrane
|
|||||
Function |
Involved in vesicular protein trafficking, mainly in the early secretory pathway. targeting. Involved in the maintenance of the Golgi apparatus. Appears to play a role in the biosynthesis of secreted cargo including processing. Involved in endoplasmic reticulum stress response. May play a role in the regulation of heat-shock response and apoptosis.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
FBPP2 Probe Info |
![]() |
20.11 | LDD0318 | [1] | |
ONAyne Probe Info |
![]() |
K39(1.56) | LDD0274 | [2] | |
STPyne Probe Info |
![]() |
K128(6.92); K152(9.28) | LDD0277 | [2] | |
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [3] | |
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [4] | |
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [5] | |
IA-alkyne Probe Info |
![]() |
N.A. | LDD0036 | [5] | |
NHS Probe Info |
![]() |
N.A. | LDD0010 | [6] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [7] | |
Crotonaldehyde Probe Info |
![]() |
N.A. | LDD0219 | [7] | |
AOyne Probe Info |
![]() |
11.00 | LDD0443 | [8] | |
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [9] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C040 Probe Info |
![]() |
6.92 | LDD1740 | [10] | |
C282 Probe Info |
![]() |
17.27 | LDD1952 | [10] | |
C388 Probe Info |
![]() |
38.85 | LDD2047 | [10] | |
C419 Probe Info |
![]() |
9.00 | LDD2074 | [10] |
Competitor(s) Related to This Target
References