Details of the Target
General Information of Target
| Target ID | LDTP08153 | |||||
|---|---|---|---|---|---|---|
| Target Name | Transmembrane emp24 domain-containing protein 4 (TMED4) | |||||
| Gene Name | TMED4 | |||||
| Gene ID | 222068 | |||||
| Synonyms |
ERS25; Transmembrane emp24 domain-containing protein 4; Endoplasmic reticulum stress-response protein 25; ERS25; GMP25iso; Putative NF-kappa-B-activating protein 156; p24 family protein alpha-3; p24alpha3
|
|||||
| 3D Structure | ||||||
| Sequence |
MAGVGAGPLRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRTQM
WDKQKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTR MALFAGGKLRVHLDIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYR EERFRLTSESTNQRVLWWSIAQTVILILTGIWQMRHLKSFFEAKKLV |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
EMP24/GP25L family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Involved in vesicular protein trafficking, mainly in the early secretory pathway. targeting. Involved in the maintenance of the Golgi apparatus. Appears to play a role in the biosynthesis of secreted cargo including processing. Involved in endoplasmic reticulum stress response. May play a role in the regulation of heat-shock response and apoptosis.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
FBPP2 Probe Info |
![]() |
20.11 | LDD0318 | [1] | |
|
ONAyne Probe Info |
![]() |
K39(1.56) | LDD0274 | [2] | |
|
STPyne Probe Info |
![]() |
K128(6.92); K152(9.28) | LDD0277 | [2] | |
|
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [3] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [4] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [5] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0036 | [5] | |
|
NHS Probe Info |
![]() |
N.A. | LDD0010 | [6] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [7] | |
|
Crotonaldehyde Probe Info |
![]() |
N.A. | LDD0219 | [7] | |
|
AOyne Probe Info |
![]() |
11.00 | LDD0443 | [8] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [9] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C040 Probe Info |
![]() |
6.92 | LDD1740 | [10] | |
|
C282 Probe Info |
![]() |
17.27 | LDD1952 | [10] | |
|
C388 Probe Info |
![]() |
38.85 | LDD2047 | [10] | |
|
C419 Probe Info |
![]() |
9.00 | LDD2074 | [10] | |
Competitor(s) Related to This Target
References
















