Details of the Target
General Information of Target
| Target ID | LDTP05362 | |||||
|---|---|---|---|---|---|---|
| Target Name | Interferon regulatory factor 8 (IRF8) |
|
||||
| Gene Name | IRF8 | |||||
| Gene ID | 3394 | |||||
| Synonyms |
ICSBP1; Interferon regulatory factor 8; IRF-8; Interferon consensus sequence-binding protein; H-ICSBP; ICSBP |
|||||
| 3D Structure | ||||||
| Sequence |
MCDRNGGRRLRQWLIEQIDSSMYPGLIWENEEKSMFRIPWKHAGKQDYNQEVDASIFKAW
AVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKC KLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQ QPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTK LYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCS GNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPL RSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRE NQQITV |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
IRF family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcription factor that specifically binds to the upstream regulatory region of type I interferon (IFN) and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)). Can both act as a transcriptional activator or repressor. Plays a negative regulatory role in cells of the immune system. Involved in CD8(+) dendritic cell differentiation by forming a complex with the BATF-JUNB heterodimer in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory element, followed by cooperative binding of BATF and IRF8 and activation of genes. Required for the development of plasmacytoid dendritic cells (pDCs), which produce most of the type I IFN in response to viral infection. Positively regulates macroautophagy in dendritic cells. Acts as a transcriptional repressor of osteoclast differentiation factors such as NFATC1 and EEIG1.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C349(2.92) | LDD3333 | [2] | |
|
IA-alkyne Probe Info |
 |
N.A. | LDD0036 | [3] | |
|
IPM Probe Info |
 |
C223(0.00); C306(0.00) | LDD2156 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0575 | Fragment13 | Ramos | C306(1.51) | LDD1470 | [5] |
| LDCM0587 | Fragment29 | Ramos | C306(1.35) | LDD1476 | [5] |
| LDCM0589 | Fragment31 | Ramos | C306(1.98) | LDD1478 | [5] |
| LDCM0571 | Fragment9 | Ramos | C306(5.54) | LDD1464 | [5] |
| LDCM0022 | KB02 | Ramos | 16.47 | LDD0431 | [6] |
| LDCM0023 | KB03 | DEL | C349(3.21) | LDD2732 | [2] |
| LDCM0024 | KB05 | MOLM-13 | C349(2.92) | LDD3333 | [2] |
| LDCM0170 | Structure8 | Ramos | 12.43; 4.81 | LDD0433 | [6] |
The Interaction Atlas With This Target
References