Details of the Target

General Information of Target

Target ID LDTP05179
Target Name SAP domain-containing ribonucleoprotein (SARNP)
Gene Name SARNP
Gene ID 84324
Synonyms
HCC1; SAP domain-containing ribonucleoprotein; Cytokine-induced protein of 29 kDa; Nuclear protein Hcc-1; Proliferation-associated cytokine-inducible protein CIP29
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MATETVELHKLKLAELKQECLARGLETKGIKQDLIHRLQAYLEEHAEEEANEEDVLGDET
EEEETKPIELPVKEEEPPEKTVDVAAEKKVVKITSEIPQTERMQKRAERFNVPVSLESKK
AARAARFGISSVPTKGLSSDNKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKER
FGIVTSSAGTGTTEDTEAKKRKRAERFGIA
Target Bioclass
Other
Subcellular location
Nucleus
Function
Binds both single-stranded and double-stranded DNA with higher affinity for the single-stranded form. Specifically binds to scaffold/matrix attachment region DNA. Also binds single-stranded RNA. Enhances RNA unwinding activity of DDX39A. May participate in important transcriptional or translational control of cell growth, metabolism and carcinogenesis. Component of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production.
Uniprot ID
P82979
Ensemble ID
ENST00000336133.8
HGNC ID
HGNC:24432

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 25 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TG42
 Probe Info  		4.40  LDD0326  [1]
C-Sul
 Probe Info  		19.33  LDD0066  [2]
AZ-9
 Probe Info  		E7(10.00)  LDD2209  [3]
ONAyne
 Probe Info  		N.A.  LDD0273  [4]
DBIA
 Probe Info  		C20(1.01)  LDD3310  [5]
BTD
 Probe Info  		C20(0.94)  LDD2112  [6]
5E-2FA
 Probe Info  		N.A.  LDD2235  [7]
ATP probe
 Probe Info  		K17(0.00); K31(0.00); K92(0.00)  LDD0199  [8]
m-APA
 Probe Info  		N.A.  LDD2233  [7]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [9]
IA-alkyne
 Probe Info  		N.A.  LDD0036  [9]
IPIAA_L
 Probe Info  		N.A.  LDD0031  [10]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [9]
JW-RF-010
 Probe Info  		N.A.  LDD0026  [11]
TFBX
 Probe Info  		N.A.  LDD0027  [11]
WYneO
 Probe Info  		N.A.  LDD0022  [12]
IPM
 Probe Info  		N.A.  LDD0005  [12]
NHS
 Probe Info  		K92(0.00); K135(0.00)  LDD0010  [12]
SF
 Probe Info  		N.A.  LDD0028  [13]
STPyne
 Probe Info  		N.A.  LDD0009  [12]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [14]
Acrolein
 Probe Info  		N.A.  LDD0217  [15]
MPP-AC
 Probe Info  		N.A.  LDD0428  [16]
NAIA_5
 Probe Info  		N.A.  LDD2223  [17]
TER-AC
 Probe Info  		N.A.  LDD0426  [16]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
VE-P
 Probe Info  		N.A.  LDD0396  [18]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0519  1-(6-methoxy-3,4-dihydroquinolin-1(2H)-yl)-2-nitroethan-1-one MDA-MB-231 C20(0.94)  LDD2112  [6]
 LDCM0524  2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide MDA-MB-231 C20(1.28)  LDD2117  [6]
 LDCM0108  Chloroacetamide HeLa H45(0.00); C20(0.00)  LDD0222  [15]
 LDCM0632  CL-Sc Hep-G2 C20(0.84)  LDD2227  [17]
 LDCM0625  F8 Ramos C20(1.76)  LDD2187  [19]
 LDCM0572  Fragment10 Ramos C20(0.85)  LDD2189  [19]
 LDCM0573  Fragment11 Ramos C20(0.40)  LDD2190  [19]
 LDCM0574  Fragment12 Ramos C20(0.84)  LDD2191  [19]
 LDCM0575  Fragment13 Ramos C20(1.61)  LDD2192  [19]
 LDCM0576  Fragment14 Ramos C20(0.79)  LDD2193  [19]
 LDCM0579  Fragment20 Ramos C20(0.64)  LDD2194  [19]
 LDCM0580  Fragment21 Ramos C20(1.42)  LDD2195  [19]
 LDCM0582  Fragment23 Ramos C20(1.92)  LDD2196  [19]
 LDCM0578  Fragment27 Ramos C20(1.35)  LDD2197  [19]
 LDCM0586  Fragment28 Ramos C20(0.46)  LDD2198  [19]
 LDCM0588  Fragment30 Ramos C20(1.97)  LDD2199  [19]
 LDCM0589  Fragment31 Ramos C20(1.19)  LDD2200  [19]
 LDCM0590  Fragment32 Ramos C20(0.81)  LDD2201  [19]
 LDCM0468  Fragment33 Ramos C20(1.39)  LDD2202  [19]
 LDCM0596  Fragment38 Ramos C20(1.00)  LDD2203  [19]
 LDCM0566  Fragment4 Ramos C20(0.66)  LDD2184  [19]
 LDCM0610  Fragment52 Ramos C20(1.74)  LDD2204  [19]
 LDCM0614  Fragment56 Ramos C20(2.27)  LDD2205  [19]
 LDCM0569  Fragment7 Ramos C20(0.58)  LDD2186  [19]
 LDCM0571  Fragment9 Ramos C20(0.75)  LDD2188  [19]
 LDCM0107  IAA HeLa C20(0.00); H45(0.00)  LDD0221  [15]
 LDCM0022  KB02 Ramos C20(0.63)  LDD2182  [19]
 LDCM0023  KB03 Ramos C20(0.66)  LDD2183  [19]
 LDCM0024  KB05 COLO792 C20(1.01)  LDD3310  [5]
 LDCM0521  Nucleophilic fragment 23b MDA-MB-231 C20(0.60)  LDD2114  [6]
 LDCM0532  Nucleophilic fragment 29a MDA-MB-231 C20(1.43)  LDD2125  [6]
 LDCM0540  Nucleophilic fragment 35 MDA-MB-231 C20(0.62)  LDD2133  [6]
 LDCM0543  Nucleophilic fragment 38 MDA-MB-231 C20(0.66)  LDD2136  [6]
 LDCM0554  Nucleophilic fragment 7a MDA-MB-231 C20(0.56)  LDD2148  [6]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ATP-dependent RNA helicase DDX39A (DDX39A) DEAD box helicase family O00148
Spliceosome RNA helicase DDX39B (DDX39B) DEAD box helicase family Q13838
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Wolframin (WFS1) . O76024
Other
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Splicing factor U2AF 35 kDa subunit (U2AF1) Splicing factor SR family Q01081
Splicing factor U2AF 65 kDa subunit (U2AF2) Splicing factor SR family P26368

References

1 Design and synthesis of tailored human caseinolytic protease P inhibitors. Chem Commun (Camb). 2018 Aug 28;54(70):9833-9836. doi: 10.1039/c8cc05265d.
Mass spectrometry data entry: PXD010277
2 Low-Toxicity Sulfonium-Based Probes for Cysteine-Specific Profiling in Live Cells. Anal Chem. 2022 Mar 15;94(10):4366-4372. doi: 10.1021/acs.analchem.1c05129. Epub 2022 Mar 4.
3 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
4 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
5 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
6 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
7 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
8 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
9 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
10 SP3-Enabled Rapid and High Coverage Chemoproteomic Identification of Cell-State-Dependent Redox-Sensitive Cysteines. Mol Cell Proteomics. 2022 Apr;21(4):100218. doi: 10.1016/j.mcpro.2022.100218. Epub 2022 Feb 25.
Mass spectrometry data entry: PXD029500 , PXD031647
11 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
12 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
13 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
14 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
15 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
16 Differently Tagged Probes for Protein Profiling of Mitochondria. Chembiochem. 2019 May 2;20(9):1155-1160. doi: 10.1002/cbic.201800735. Epub 2019 Mar 26.
17 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
18 Pharmacological Targeting of Vacuolar H(+)-ATPase via Subunit V1G Combats Multidrug-Resistant Cancer. Cell Chem Biol. 2020 Nov 19;27(11):1359-1370.e8. doi: 10.1016/j.chembiol.2020.06.011. Epub 2020 Jul 9.
19 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578